Acesse a área exclusiva e obtenha informações detalhadas dos processos de importação.


Veja na lista abaixo os produtos mais importados para este NCM.

COMPOST AID CONCENTRATE II. MISTURA DE MICROORGANISMOS. FINALIDADE DA IMPORTAÇÃO: MATÉRIA PRIMA PARA PRODUÇÃO DE ADITIVO DE COMPOSTAGEM. NATUREZA FÍSICA: SÓLIDO. TIPO DE EMBALAGEM: SACOS DE DE 25 KG.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PAN00603263 ENTEROGERMINA 4BCFU/5ML SUSP BT5 FC BR - NOME COMERCIAL: ESPOROS DE BACILLUS CLAUSII EM SUSPENSAO - CATEGORIA: SUBSTANCIAS BIOATIVAS E PROBIOTICOS ISOLADOS COM ALEGACAO DE PROPRIEDADES FUNCIONAIS E/OU DE SAUDE. - REGISTRO: 6.7450.0001.001
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PAN00446018 ENTEROGERMINA 2BCFU/5ML SUSP BTX10 BR - NOME COMERCIAL: ESPOROS DE BACILLUS CLAUSII EM SUSPENSAO - CATEGORIA: SUBSTANCIAS BIOATIVAS E PROBIOTICOS ISOLADOS COM ALEGACAO DE PROPRIEDADES FUNCIONAIS E/OU DE SAUDE. - DESCRICAO: ALIMENTO FUNCIO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PAN00446018 ENTEROGERMINA 2BCFU/5ML SUSP BTX10 BR - NOME COMERCIAL: ESPOROS DE BACILLUS CLAUSII EM SUSPENSAO - CATEGORIA: SUBSTANCIAS BIOATIVAS E PROBIOTICOS ISOLADOS COM ALEGACAO DE PROPRIEDADES FUNCIONAIS E/OU DE SAUDE. - DESCRICAO: ALIMENTO FUNCIO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PAN00446018 ENTEROGERMINA 2BCFU/5ML SUSP BTX10 BR - NOME COMERCIAL: ESPOROS DE BACILLUS CLAUSII EM SUSPENSAO - CATEGORIA: SUBSTANCIAS BIOATIVAS E PROBIOTICOS ISOLADOS COM ALEGACAO DE PROPRIEDADES FUNCIONAIS E/OU DE SAUDE. - DESCRICAO: ALIMENTO FUNCIO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PAN00603263 ENTEROGERMINA 4BCFU/5ML SUSP BT5 FC BR - NOME COMERCIAL: ESPOROS DE BACILLUS CLAUSII EM SUSPENSAO - CATEGORIA: SUBSTANCIAS BIOATIVAS E PROBIOTICOS ISOLADOS COM ALEGACAO DE PROPRIEDADES FUNCIONAIS E/OU DE SAUDE. - REGISTRO: 6.7450.0001.001
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

61015954 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO. SENDO: NOME COMERCIAL: KP - HOWARU Dophilus 200B - 1 KG (PAREVE) Descricao: Cultura probiotica liofilizada. Cor branca a creme.Composicao: Lactobacillus acidophilus (NCFM)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

7100208296 / 70201177840 / 95989 / 001 - PACOTE TESTE DESAFIO MODELO 41482V. UTILIZADO NO PROCESSO DE ESTERILIZACAO POR VAPOR NA AREA DA SAUDE. COMPOSTO COM UM INTEGRADOR QUIMICO STERIGAGE E UM INDICADOR BIOLOGICO (GEOBACILLUS STEAROTHERMOPHILUS) DE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

7100208296 / 70201177840 / 95143 / 001 - PACOTE TESTE DESAFIO MODELO 41482V. UTILIZADO NO PROCESSO DE ESTERILIZACAO POR VAPOR NA AREA DA SAUDE. COMPOSTO COM UM INTEGRADOR QUIMICO STERIGAGE E UM INDICADOR BIOLOGICO (GEOBACILLUS STEAROTHERMOPHILUS) DE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P0622 FAMILIA ALINITY I ANTI-HCV APRESENTACAO: ALINITY I ANTI-HCV REAGENT KIT - MICROPARTICULAS: 2 X 6,6 ML/CONJUGADO: 2 X 6,1 ML/DILUENTE DE ENSAIO: 2 X 10,4 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO HCV (E.COLI, LEVEDURA, RECOMBI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P0622 FAMILIA ALINITY I ANTI-HCV APRESENTACAO: ALINITY I ANTI-HCV REAGENT KIT - MICROPARTICULAS: 2 X 6,6 ML/CONJUGADO: 2 X 6,1 ML/DILUENTE DE ENSAIO: 2 X 10,4 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO HCV (E.COLI, LEVEDURA, RECOMBI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

61015954 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO. SENDO: NOME COMERCIAL: KP - HOWARU Dophilus 200B - 1 KG (PAREVE) Descricao: Cultura probiotica liofilizada. Cor branca a creme.Composicao: Lactobacillus acidophilus (NCFM)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

58163301 - INTEGRAL®,20X0,15 L,BR NOME VULGAR/ COMERCIAL: INTEGRAL® NOME CIENTÍFICO/ TÉCNICO: BACILLUS AMYLOLIQUEFACIENS FORMA: LIQUIDA APRESENTAÇÃO: UMA CAIXA DE PAPELÃO CONTENDO 20 FRASCOS DE 150 ML DE PRODUTO EM CADA. APLICAÇÃO USO E EMPREGO: INOC
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PAN00603263 ENTEROGERMINA 4BCFU/5ML SUSP BT5 FC BR - NOME COMERCIAL: ESPOROS DE BACILLUS CLAUSII EM SUSPENSAO - CATEGORIA: SUBSTANCIAS BIOATIVAS E PROBIOTICOS ISOLADOS COM ALEGACAO DE PROPRIEDADES FUNCIONAIS E/OU DE SAUDE. - REGISTRO: 6.7450.0001.001
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

717225 - Cultura de microrganismos congelados (Lactobacillus rhamnosus) empregados como fermentos lácteos na preparação de derivados de leite iogurte, quefir, ácido lático)F-DVS FreshQ® 10 - cada caixa contem 10 pacotes
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

58260758 - GELFIX5 BE SOJA,4X3 L,BR DESCRIÇÃO: CULTURA DE MICROORGANISMOS - INOCULANTE BIOLÓGICO AGRÍCOLA A BASE DE BRADYRHIZOBIUM ELKANII SEMIA NOME COMERCIAL: GELFIX5 BE SOJA NOME CIENTIFICO / TECNICO: BRADYRHIZOBIUM ELKAMIA SEMIA 587 E 5019 FORMA:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

707753 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-9 - Cada caixa contém 10ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6032 FAMILIA ALINITY I SYPHILIS TP APRESENTACAO.: ALINITY I SYPHILIS TP REAGENT KIT - MICROPARTICULAS: 2 X 16,8 ML/CONJUGADO: 2 X 16,3 ML/DILUENTE DE ENSAIO: 2 X 28,7 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO TP (E.COLI, RECOMBINA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90963 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO.: NOME COMERCIAL: LACTOBACILLUS PLUS LYO 150 DCU DESCRICAO: Misturas de cepas de bacterias laticas selecionadas para inoculacao direta em leite e outros alimentos.LOTE:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ADITIVO B-220 SKU WTP901P42-27 - ( Uso como biorremediador em Estações de Tratamento de Efluentes de laticínios e frigoríficos, para degradar a matéria orgânica (óleo e gorduras). PRODUTO : Granulado EMBALAGEM PRIMARIA : Saco Plástico Hidrossolúvel C
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

707752 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-08 10X500U - cada caixa contem 10 Ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6032 FAMILIA ALINITY I SYPHILIS TP APRESENTACAO.: ALINITY I SYPHILIS TP REAGENT KIT - MICROPARTICULAS: 2 X 16,8 ML/CONJUGADO: 2 X 16,3 ML/DILUENTE DE ENSAIO: 2 X 28,7 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO TP (E.COLI, RECOMBINA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

IMUNOENSAIO PARA DETERMINACAO QUANTITATIVA IN VITRO DA TROPONINA T CARDIACA EM SORO E PLASMA HUMANOS. FAMILIA ELECSYS TROPONIN T HS TROPONIN T HS STAT ELECSYS COBAS E100 V2 P/N: 08469814190 APRESENTACAO: ELECSYS TROPONIN T HS STAT - 100 TESTES - M 6,
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704889 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-6 - Cada caixa contém 10ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

709107 - Cultura de microrganismos congelados (Lactobacillus delbrueckii subsp. bulgaricus Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS DN WHITE-2- cada cx cont
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

715461 - Cultura de microrganismos liofilizados (Lactobacillus helveticus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS TCC-52 de 200U - cada caixa contem 25ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

707752 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-08 10X500U - cada caixa contem 10 Ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

705901 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-07 10X500U - cada caixa contem 10 Ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

715693 - Culturas de microrganismos congeladas (Streptococcus thermophilus), empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS® STI-10?X500U (antigo SoMozz Daily 1.1) - Cada caixa contém 10 env
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P0622 FAMILIA ALINITY I ANTI-HCV APRESENTACAO: ALINITY I ANTI-HCV REAGENT KIT - MICROPARTICULAS: 2 X 6,6 ML/CONJUGADO: 2 X 6,1 ML/DILUENTE DE ENSAIO: 2 X 10,4 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO HCV (E.COLI, LEVEDURA, RECOMBI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

Cultura de micro-organismos, cultura de bacterias apresentada em saches, na forma de po. Materia-prima destinada a comercializacao a farmacias magistrais para a manipulacao de preparacoes magistrais dispensadas sob prescricao de profissional legalmen
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704747 - Cultura de microrganismo congelado (Streptococcus thermophilu, Lactobacillus delbrueckii subsp. bulgaricus, Lactococcus and bifidobacterium) empregada como fermento lácteo na preparação de iogurte- F-DVS - DN 560003 - caixas contendo 10 enve
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6032 FAMILIA ALINITY I SYPHILIS TP APRESENTACAO.: ALINITY I SYPHILIS TP REAGENT KIT - MICROPARTICULAS: 2 X 16,8 ML/CONJUGADO: 2 X 16,3 ML/DILUENTE DE ENSAIO: 2 X 28,7 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO TP (E.COLI, RECOMBINA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

715461 - Cultura de microrganismos liofilizados (Lactobacillus helveticus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS TCC-52 de 200U - cada caixa contem 25ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

717225 - Cultura de microrganismos congelados (Lactobacillus rhamnosus) empregados como fermentos lácteos na preparação de derivados de leite iogurte, quefir, ácido lático)F-DVS FreshQ® 10 - cada caixa contem 10 pacotes
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08H5902 CELL-DYN 26 PLUS CONTROL (LOW, NORMAL AND HIGH) APRESENTACAO: MEIA EMBALAGEM: 6 TUBOS DE 2,5 ML CADA, SENDO CONTROLE BAIXO, CONTROLE NORMAL E CONTROLE ALTO. CELL-DYN 26 PLUS CONTROL E UM REAGENTE PARA USO DIAGNOSTICO IN VITRO, CONTENDO COMPON
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CULTURA DE MICROORGANISMOS UTILIZADA COMO MATERIA PRIMA PARA FABRICAÇÃO DO PRODUTO BIOLÓGICO ENZILIMP, REGISTRO ANVISA: 323850008. NOME COMERCIAL: BIOREMOVE FOB BOOST, MARCA COMERCIAL: NOVOZYMES BIOLOGICAL INC. LOTE NUMERO: 031D026; 103D529; 051D334.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

715693 - Culturas de microrganismos congeladas (Streptococcus thermophilus), empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS® STI-10?X500U (antigo SoMozz Daily 1.1) - Cada caixa contém 10 env
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

61015875 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO. SENDO: NOME COMERCIAL: KP - Lc-11 300B - 1 KG (PAREVE) Descricao: Cultura probiotica liofilizada. Cor branca a creme. Composicao: Lactobacillus casei (Lc-11)Embalagem: Sac
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

710999 - Cultura de microrganismos congelados (Lactobacillus paracasei) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS FreshQ® 5 - cada caixa contem 10ev.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

707753 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-9 - Cada caixa contém 10ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

707753 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-9 - Cada caixa contém 10ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704952 - Cultura de microrganismos congelados (Streptococcus thermophilus, Lactobacillus fermentum e Lactobacillus delbrueckii subsp. bulgaricus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-D
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704889 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-6 - Cada caixa contém 10ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

HDL REAGENTE 2 PARA DETERMINACAO DIRETA E HOMOGENEA DO COLESTEROL DA LIPOPROTEINA DE ALTA DENSIDADE (HDL) - REF.:55377-9 (KIT) 58381 (BULK) COMPOSTO DE ENZIMAS COLESTEROL OXIDASE, COLESTEROL ESTERASE E PEROXIDASE, COMO COMPONENTES PRINCIPAIS DA FORMU
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

715383 - Cultura de microrganismo liofilizado (Lactobacillus sakei, Pediococcus acidilactici e Staphylococcus carnosus), para uso exlusivo em indústrias cárnicas para fermantação em embutidos, marca: SafePro® FLORA ITALIA LC US. Cada caixa contém 25
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

712990 - Cultura de microrganismos liofilizados (Debaryomyces hansenii, Lactobacillus sakei, Pediococcus acidilactici, Pediococcus pentosaceus, Staphylococcus carnosus e Staphylococcus xylosus) empregada como fermento em produtos embutidos nas indust
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

7100208296 / 70201177840 / 96752 / 001 - PACOTE TESTE DESAFIO MODELO 41482V. UTILIZADO NO PROCESSO DE ESTERILIZACAO POR VAPOR NA AREA DA SAUDE. COMPOSTO COM UM INTEGRADOR QUIMICO STERIGAGE E UM INDICADOR BIOLOGICO (GEOBACILLUS STEAROTHERMOPHILUS) DE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P0732 FAMILIA ALINITY I HIV AG/AB COMBO APRESENTACAO: ALINITY I HIV AG/AB COMBO REAGENT KIT - MICROPARTICULAS: 2 X 32,1 ML/CONJUGADO: 2 X 31,6 ML/DILUENTE DE ENSAIO: 2 X 31,8 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO HIV-1/HIV-2 (
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 122 S, 5U Descricao do produto: Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. SY210840 - prod. 26/03/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

700002632 / 70200620527 / 95946 / 001 - CULTURA DE MICROORGANISMOS. INDICADOR BIOLOGICO, CONTENDO CULTURA DE MICROOORGANISMOS (B.STEAROTHERMOPHILUS)EM TIRAS DE PAPEL DE FILTRO, ARMAZENADAS EM F RASCOS PLASTICOS, UTILIZADO PARA MONITORAR ESTERILIZACAO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 123,DSF,5U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de cido l tico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. SY210960, prod. 07/04/2
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO FRESH YS-241, 10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. GT00049121 - prod. 15/04/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

715693 - Culturas de microrganismos congeladas (Streptococcus thermophilus), empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS® STI-10?X500U (antigo SoMozz Daily 1.1) - Cada caixa contém 10 env
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704996 - Cultura de microrganismo congelado ( Lactobacillus delbrueckii subsp. bulgaricus, Lactobacillus fermentum e Streptococcus thermophilus ) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-D
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P0732 FAMILIA ALINITY I HIV AG/AB COMBO APRESENTACAO: ALINITY I HIV AG/AB COMBO REAGENT KIT - MICROPARTICULAS: 2 X 32,1 ML/CONJUGADO: 2 X 31,6 ML/DILUENTE DE ENSAIO: 2 X 31,8 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO HIV-1/HIV-2 (
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

707753 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-9 - Cada caixa contém 10ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 124,DSF,5U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de cido l tico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lotes nrs. SY359694/60, SY210953
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

61005274 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO. SENDO: NOME COMERCIAL: KP-BL-04 500B-1KG (PAREVE) Descricao: Cultura probiotica liofilizada. Cor branca a creme. Composicao: Bifidobacterium lactis (Bl-04)Embalagem: Embal
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50353 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO NOME COMERCIAL: LBC81 LYO 10 D (Lactobacilli) DESCRICAO: Cultura desenvolvedora de aroma para queijo. LOTE: 4413853885 - 4,800 kgs (800 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 126 S, 10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. SY211051 - prod. 20/04
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 122,DSF,10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lotes nrs. GT00048523, GT00048
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 125 S, 10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. SY211050 - prod. 20/04
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO FRESH YG-131, 10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. 606484/10 - prod. 21/04/2
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

719957 - Cultura de microrganismos congelados (Streptococcus thermophilus, Lactobacillus delbrueckii subsp. Bulgaricus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS YoFlex® Mild 1.0 - cada
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

715693 - Culturas de microrganismos congeladas (Streptococcus thermophilus), empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS® STI-10?X500U (antigo SoMozz Daily 1.1) - Cada caixa contém 10 env
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PRODUTO:. DELVO CHEESE CP CP 121 S, 5U DESCRICAO DO PRODUTO: CULTURAS CONGELADAS ALTAMENTE CONCENTRADAS DE BACTERIAS PRODUTORAS DE ACIDO LATICO; FINALIDADE: UTILIZACAO NA FABRICACAO DE QUEIJOS E IOGURTES NA INDUSTRIA DE LATICINIOS;LOTE NR.: SY211030
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704994 - Cultura de microrganismo congelados (Lactobacillus delbrueckii subsp. bulgaricus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS YoFlex® Advance 1.2 - C
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

686901 - Cultura de microrganismos liofilizados (Lactobacillus plantarum) empregada como fermento em produtos embutidos nas indústrias frigorificas - Bactoferm SM 199 - Cada caixa contém 50 ev. de 25g cada.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

705257 - Culturas de microrganismos congelados (Lactobacillus helveticus) empregados como fermentos lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS LH-B03. Cada caixa contém 10 pacotes de 500U
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

707752 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-08 10X500U - cada caixa contem 10 Ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

705901 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-07 10X500U - cada caixa contem 10 Ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

705901 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-07 10X500U - cada caixa contem 10 Ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

710781 - Culturas de microrganismos congelados ( Streptococcus thermophilus, Lactobacillus delbrueckii subsp. Bulgaricus, Lactobacillus helveticus, Lactobacillus paracasei )empregados como fermentos lácteos na preparação de derivados de leite (iogurt
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

Cultura de micro-organismos, cultura de bacterias apresentada em saches, na forma de po. Materia-prima destinada a comercializacao a farmacias magistrais para a manipulacao de preparacoes magistrais dispensadas sob prescricao de profissional legalmen
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

705901 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-07 10X500U - cada caixa contem 10 Ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

51193 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO:MARCA COMERCIAL: TEXEL SA-201 200 kg. DESCRICAO: Trata-se de uma cultura de maturacao liofilizada, desenvolvida especialmente para texturizacao, aromatizacao e coloraca
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704889 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-6 - Cada caixa contém 10ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

705257 - Culturas de microrganismos congelados (Lactobacillus helveticus) empregados como fermentos lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS LH-B03. Cada caixa contém 10 pacotes de 500U
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 121,DSF,10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lotes nrs. GT00048506, GT00048
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 124,DSF,10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lotes nrs GT00046568, GT000466
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 121,DSF,10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lotes nrs. GT00047300, GT00047
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1279861 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO : NOME COMERCIAL: CHOOZIT SWIFT 524 FRO 750 DCU.DESCRICAO: CULTURA CONGELADA DE STREPTOCOCCUS THERMOPHILUS ALTAMENTE CONCENTRADA, DE RAPIDA ACIDIFICACAO, FORMANDO ACIDO LACTICO TIPO L(+).
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

710781 - Culturas de microrganismos congelados ( Streptococcus thermophilus, Lactobacillus delbrueckii subsp. Bulgaricus, Lactobacillus helveticus, Lactobacillus paracasei )empregados como fermentos lácteos na preparação de derivados de leite (iogurt
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

501095 - Cultura de microrganismos liofilizados (Pediococcus pentosaceus e Staphylococcus xylosus) empregada como fermento em produtos embutidos nas indústrias frigorificas - Bactoferm T-SPX 100 - Cada caixa contém 50 ev. de 25g cada.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

710782 - Culturas de microrganismos congelados (Lactobacillus delbrueckii subsp. bulgaricus, Streptococcus thermophilus Lactobacillus helveticus e Lactobacillus paracasei) empregados como fermentos lácteos na preparação de derivados de leite (iogurte
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

710781 - Culturas de microrganismos congelados ( Streptococcus thermophilus, Lactobacillus delbrueckii subsp. Bulgaricus, Lactobacillus helveticus, Lactobacillus paracasei )empregados como fermentos lácteos na preparação de derivados de leite (iogurt
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: CRO01-01000 - CROTAMINA, PEPTÍDEO DE PENETRAÇÃO CELULAR E BLOQUEADOR DE CANAIS IÔNICOS ? SEQUÊNCIA AA: YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH - 16 X 1MG - LOTE: 7334_B
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

719958 - Cultura de microrganismos congelados (Streptococcus thermophilus, Lactobacillus delbrueckii subsp. Bulgaricus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS YoFlex Premium 1.0 - ca
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

714891 - Cultura de microrganismos liofilizados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS STI-15 - cada caixa contem 25ev.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704952 - Cultura de microrganismos congelados (Streptococcus thermophilus, Lactobacillus fermentum e Lactobacillus delbrueckii subsp. bulgaricus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-D
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

712846 - Cultura de microrganismos liofilizados (Staphylococcus carnosus e Lactobacillus sakei) empregada como fermento em produtos embutidos nas indústrias frigorificas - BFL-F09 - Cada caixa contém 50 ev. de 25g cada.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

686901 - Cultura de microrganismos liofilizados (Lactobacillus plantarum) empregada como fermento em produtos embutidos nas indústrias frigorificas - Bactoferm SM 199 - Cada caixa contém 50 ev. de 25g cada.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

667331 - Cultura de microrganismos liofilizada (Lactobacillus delbrueckii subsp. bulgaricus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD - DVS YF-L811-cada cx cont
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704747 - Cultura de microrganismo congelado (Streptococcus thermophilu, Lactobacillus delbrueckii subsp. bulgaricus, Lactococcus and bifidobacterium) empregada como fermento lácteo na preparação de iogurte- F-DVS - DN 560003 - caixas contendo 10 enve
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

690807 - Culturas de microrganismos congelados (Streptococcus thermophilus) empregados como fermentos lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-ES i410 - Cada cx contem 5 pacotes de 1000U
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

Cultura de micro-organismos, cultura de bacterias apresentada em saches, na forma de po. Materia-prima destinada a comercializacao a farmacias magistrais para a manipulacao de preparacoes magistrais dispensadas sob prescricao de profissional legalmen
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

705261 - Culturas de microrganismos congeladas (Lactobacillus delbrueckii subsp. bulgaricus e Streptococcus thermophilus), empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS YoFlex® Premium 3.0
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

689846 - Culturas de microrganismos congelados (Streptococcus thermophilus) empregados como fermentos lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-ES i405 - Cada cx contem 5 pacotes de 1000U
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704989 - Cultura de microrganismo congelados Lactobacillus delbrueckii subsp. bulgaricus Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS YF-L902 cada caixa contend
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

9009618 - LINHA CELULAR (BAF3-HUMAN-GHR-MONO6, 1ML - IN VITRO OR IN VIVO USE IN LABORATORY ORGANISMS ONLY) *** PESO LIQ: 0,2LB APROX 0,090718KG / APARENCIA: LIQUIDO / COR: TRANSLUCIDO / CLASSE: NAO APLICAVEL / PROCESSO DE OBTENCAO: DNA RECOMBINANTE /
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

719958 - Cultura de microrganismos congelados (Streptococcus thermophilus, Lactobacillus delbrueckii subsp. Bulgaricus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS YoFlex Premium 1.0 - ca
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P8957 FAMILIA ALINITY I ANTI-HBS APRESENTACAO: ALINITY I ANTI-HBS REAGENT KIT - MICROPARTICULAS: 2 X 19,9 ML/CONJUGADO: 2 X 31,6 ML/DILUENTE DE AMOSTRA: 2 X 14,7 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO DE SUPERFICIE DA HEPATITE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

719958 - Cultura de microrganismos congelados (Streptococcus thermophilus, Lactobacillus delbrueckii subsp. Bulgaricus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS YoFlex Premium 1.0 - ca
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704748 - Cultura de microrganismos congelados (Bifidobacterium species DN173010) empregada como fermento lácteo na preparação de iogurte- F-DVS - DN 673010 500grs - caixas contendo 10 envelopes cada
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 123,DSF,10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lotes nrs. GT00046139, GT00047
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 124,DSF,10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote ns. GT00047929 - prod. 19
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: NTER NOTA PEG4 CROTAMINE - PEPTÍDEO CROTAMINA-PEG4-NOTA - 3 X 1MG - LOTE: 8513_A
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1279947 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: CHOOZIT SWIFT 522 FRO 750 DCU.DESCRICAO: CULTURA CONGELADA DE STREPTOCOCCUS THERMOPHILUS ALTAMENTE CONCENTRADA, DE RAPIDA ACIDIFICACAO, FORMANDO ACIDO LACTICO TIPO L(+).CH
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1277838 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO : NOME COMERCIAL: CHOOZIT SWIFT 516 FRO 750 DCUDESCRICAO: Caracteriza-se como cultura congelada de microrganismos, mais particularmente como culturas de Streptococcus thermophilus altament
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1277647 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: CHOOZIT SWIFT 512 FRO 750 DCUDESCRICAO: Caracteriza-se como cultura congelada de microrganismos, mais particularmente como culturas de Streptococcus thermophilus altamente
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704748 - Cultura de microrganismos congelados (Bifidobacterium species DN173010) empregada como fermento lácteo na preparação de iogurte- F-DVS - DN 673010 500grs - caixas contendo 10 envelopes cada
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

61015076 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO. SENDO: NOME COMERCIAL: KP - Lpc-37 400B - 1 KG (PAREVE) Descricao: Cultura probiotica liofilizada. Cor branca a creme. Composicao: Lactobacillus paracasei (Lpc-37)Embalage
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

719957 - Cultura de microrganismos congelados (Streptococcus thermophilus, Lactobacillus delbrueckii subsp. Bulgaricus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS YoFlex® Mild 1.0 - cada
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

710781 - Culturas de microrganismos congelados ( Streptococcus thermophilus, Lactobacillus delbrueckii subsp. Bulgaricus, Lactobacillus helveticus, Lactobacillus paracasei )empregados como fermentos lácteos na preparação de derivados de leite (iogurt
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

719957 - Cultura de microrganismos congelados (Streptococcus thermophilus, Lactobacillus delbrueckii subsp. Bulgaricus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS YoFlex® Mild 1.0 - cada
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

61013138 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZITDESCRICAO: Culturas lacticas congeladas em palets para inoculacao direta em leite. Composta de Lactococcus lactis subsp. lactis e Streptococ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

61013132 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL.: CHOOZIT MR802 FRO 250 DCU Culturas Lacticas congeladas em peletes para inoculacao direta em leite. EMBALAGEM: SACHET DE PE LOTE: 4113875891 - 242,500 kgs (970 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

668365 - Culturas de microrganismos congelados (Streptococcus thermophilus) empregados como fermentos lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-ES i450 - Cada cx contem 5 pacotes de 1000U
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CP 121, 300G Descricao do produto: Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. GT00048500 - prod. 23/03/21 - venc.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CP 502, 10U Descricao do produto: Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. GT00048063 - prod. 17/02/21 - venc. 1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 504, 10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lotes nrs. GT00047653, GT00048027
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

707752 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-08 10X500U - cada caixa contem 10 Ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

707752 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-08 10X500U - cada caixa contem 10 Ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

61013135 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: CHOOZIT MR804 FRO 250 DCU (PD 275437-1.0PT) CULTURAS LACTICAS CONGELADAS EM PELETES PARA INOCULACAO DIRETA EM LEITE EMBALAGEM: SACHET DE PE LOTE: 4113871209 - 230,000 kgs (920 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

671879 - Cultura de microrganismos liofilizados (Pediococcus acidilactici) empregada como fermento em produtos embutidos nas industrias frigorificas - Bactoferm B-LC-20 - cada caixa contém 50 envelopes.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

667331 - Cultura de microrganismos liofilizada (Lactobacillus delbrueckii subsp. bulgaricus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD - DVS YF-L811-cada cx cont
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

Cultura de micro-organismos, cultura de bacterias apresentada em saches, na forma de po. Materia-prima destinada a comercializacao a farmacias magistrais para a manipulacao de preparacoes magistrais dispensadas sob prescricao de profissional legalmen
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1277836 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: CHOOZIT SWIFT 514 FRO 750 DCUDESCRICAO: Caracteriza-se como cultura congelada de microrganismos, mais particularmente como culturas de Streptococcus thermophilus altamente
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

705261 - Culturas de microrganismos congeladas (Lactobacillus delbrueckii subsp. bulgaricus e Streptococcus thermophilus), empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS YoFlex® Premium 3.0
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1281183 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: CHOOZIT SWIFT 526 FRO 750 DCU CULTURA CONGELADA DE STREPTOCOCCUS THERMOPHILUS ALTAMENTE CONCENTRADA, DE RAPIDA ACIDIFICACAO, FORMANDO ACIDO LACTICO TIPO L(+).CHOOZIT SWIFT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO FRESH FC-214, 5U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. GT00048496 - prod. 22/03/2
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

710782 - Culturas de microrganismos congelados (Lactobacillus delbrueckii subsp. bulgaricus, Streptococcus thermophilus Lactobacillus helveticus e Lactobacillus paracasei) empregados como fermentos lácteos na preparação de derivados de leite (iogurte
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6022 FAMILIA ALINITY I SYPHILIS TP APRESENTACAO: ALINITY I SYPHILIS TP REAGENT KIT - MICROPARTICULAS:2 X 4,2 ML/CONJUGADO: 2 X 4,2 ML/DILUENTE DE ENSAIO: 2 X 5,9 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO TP (E.COLI, RECOMBINANTE)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

502360 - Culturas de microorganismos liofilizados (Staphylococcus carnosus), empregados como fermentos em produtos cárnicos - marca: Bactoferm® S-B-61. Cada caixa contém 50 ev. de 25g cada.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1102740002 COD. DO ITEM: 1102740002, NOME COMERCIAL: STERIKON BIOINDICADOR, NOME CIENTIFICO: SUSPENSAO DE ESPOROS GEOBACILLUS STEAROTHERMOPHILUS, CONCENTRACAO: 5.0E+05 - 1.0E+07 SPOROS POR UNIDADE, DENSIDADE: 1 G/CM3, COR: VIOLETA AVERMELHADA, ODOR:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 124, 10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. GT00048541 - prod. 07/04
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PRODUTO:. DELVO CHEESE CP 125,DSF,5U DESCRICAO DO PRODUTO: CULTURAS CONGELADAS ALTAMENTE CONCENTRADAS DE BACTERIAS PRODUTORAS DE ACIDO LATICO; FINALIDADE: UTILIZACAO NA FABRICACAO DE QUEIJOS E IOGURTES NA INDUSTRIA DE LATICINIOS;LOTE NR.: SY211035 -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PRODUTO:. DELVO CHEESE CP 126,DSF,5U DESCRICAO DO PRODUTO: CULTURAS CONGELADAS ALTAMENTE CONCENTRADAS DE BACTERIAS PRODUTORAS DE ACIDO LATICO; FINALIDADE: UTILIZACAO NA FABRICACAO DE QUEIJOS E IOGURTES NA INDUSTRIA DE LATICINIOS;LOTE NR.: SY211036 -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704646 - Cultura de microrganismos congelados (Lactobacillus helveticus, Lactococcus lactis subsp, Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS RSF-637 - cada c
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704646 - Cultura de microrganismos congelados (Lactobacillus helveticus, Lactococcus lactis subsp, Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS RSF-637 - cada c
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6132 FAMILIA ALINITY I RHTLV-I/II APRESENTACAO: ALINITY I RHTLV-I/II REAGENT KIT - MICROPARTICULAS: 2 X 27,0 ML/CONJUGADO: 2 X 26,5 ML/DILUENTE DE ENSAIO: 2 X 35,4 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE PEPTIDEO SINTETICO DO HTLV-I/HTLV
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

13930073 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: P. roqueforti PV LYO 10 D DESCRICAO: Cultura liofilizada para inoculacao direta em leite. LOTE: 4113850560 - 1,600 kgs (400 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

Cultura de micro-organismos, cultura de bacterias apresentada em saches, na forma de po. Materia-prima destinada a comercializacao a farmacias magistrais para a manipulacao de preparacoes magistrais dispensadas sob prescricao de profissional legalmen
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

690807 - Culturas de microrganismos congelados (Streptococcus thermophilus) empregados como fermentos lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-ES i410 - Cada cx contem 5 pacotes de 1000U
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

690807 - Culturas de microrganismos congelados (Streptococcus thermophilus) empregados como fermentos lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-ES i410 - Cada cx contem 5 pacotes de 1000U
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P8732 FAMILIA ALINITY I ANTI-HBC II APRESENTACAO: ALINITY I ANTI-HBC II REAGENT KIT - MICROPARTICULAS: 2 X 16,8 ML/ CONJUGADO: 2 X 17,8 ML/DILUENTE DE ENSAIO: 2X 15,3 ML/DILUENTE DE AMOSTRA: 2 X 15,1 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

689846 - Culturas de microrganismos congelados (Streptococcus thermophilus) empregados como fermentos lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-ES i405 - Cada cx contem 5 pacotes de 1000U
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

689846 - Culturas de microrganismos congelados (Streptococcus thermophilus) empregados como fermentos lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-ES i405 - Cada cx contem 5 pacotes de 1000U
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

717896 - Culturas de microrganismos congeladas (Lactobacillus rhamnosus), empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS FreshQ® 9 - Cada caixa contém 10 envelopes.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1102740002 COD. DO ITEM: 1102740002, NOME COMERCIAL: STERIKON BIOINDICADOR, NOME CIENTIFICO: SUSPENSAO DE ESPOROS GEOBACILLUS STEAROTHERMOPHILUS, CONCENTRACAO: 5.0E+05 - 1.0E+07 SPOROS POR UNIDADE, DENSIDADE: 1 G/CM3, COR: VIOLETA AVERMELHADA, ODOR:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1102740002 COD. DO ITEM: 1102740002, NOME COMERCIAL: STERIKON BIOINDICADOR, NOME CIENTIFICO: SUSPENSAO DE ESPOROS GEOBACILLUS STEAROTHERMOPHILUS, CONCENTRACAO: 5.0E+05 - 1.0E+07 SPOROS POR UNIDADE, DENSIDADE: 1 G/CM3, COR: VIOLETA AVERMELHADA, ODOR:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1277647 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: CHOOZIT SWIFT 512 FRO 750 DCUDESCRICAO: Caracteriza-se como cultura congelada de microrganismos, mais particularmente como culturas de Streptococcus thermophilus altamente
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 123 S, 5U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. SY210960 - prod. 07/04/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (JOY-L0B-02 1 - 25 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (JOY-L0B-02 2 - 25 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (TOM F-05 2 - 25 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6022 FAMILIA ALINITY I SYPHILIS TP APRESENTACAO: ALINITY I SYPHILIS TP REAGENT KIT - MICROPARTICULAS:2 X 4,2 ML/CONJUGADO: 2 X 4,2 ML/DILUENTE DE ENSAIO: 2 X 5,9 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO TP (E.COLI, RECOMBINANTE)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

501110 - Cultura de microrganismos liofilizados (Staphylococcus xylosus) empregada como fermento em produtos embutidos em industrias frigoríficas - Bactoferm S-SX 100. Cada caixa contém 50 ev. de 25g cada.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704949 - Culturas de microrganismos congelados (Lactobacillus delbrueckii subsp. bulgaricus e Streptococcus thermophilus) empregadas como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS YF-LX700 - Cada cx c
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO FRESH YS-241, 5U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. GT00047666 - prod. 21/02/2
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CP 503, 10U Descricao do produto: Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lotes nrs. GT00047576, GT00047805 - prod. 27/0
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 503, 10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. GT00047652 - prod. 17/02
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CP 504, 10U Descricao do produto: Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. GT00047653 - prod. 08/02/21 - venc. 0
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO YOG FVV-122 DSF 10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. 606484/20 - prod. 21/04
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE NEGATIVO E POSITIVO PARA UTILIZACAO COM O ENSAIO ANTI-SARS-COV-2 (COVID-19). O CONTROLE PRECICONTROL ANTI SARS COV 2 E UM SORO DE CONTROLE PRONTO A UTILIZAR BASEADO EM SORO HUMANO. OS CONTROLES SAO UTILIZADOS PARA MONITORIZAR A EXATIDAO DO I
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO FRESH FC-211, 5U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. GT00048279 - prod. 08/03/2
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (BIO-RHM - 10 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

693646 - Culturas de microrganismos congelados (Streptococcus thermophilus) empregados como fermentos lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-ES i415 - Cada cx contem 5 pacotes de 1000U
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM PG 250 U IDC, ROTACAO 1 CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA. NUMERO DE LOTE: M2306Q.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM PG 250 U IDC, ROTACAO 3 CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306S.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM PG 250 U IDC, ROTACAO 2 CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA. NUMERO DE LOTE: M2306R.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 740930-BL - PAINEL DE RESPOSTA IMUNE ESSENCIAL HU LEGENDPLEX? (13-PLEX) COM VBP - 100 TESTES - FABRICANTE: BIOLEGEND INC, 9727 PACIFIC HEIGHTS BLVD, CA 92121 - SAN DIEGO - USA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS BULGARICUS CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/A NATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA-PRIMATEMPERATU
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

13850065 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: HOLDBAC YM-B LYO 500 DCU DESCRICAO: Cultura Liofilizada. Cultura de multiplas especies definidas. LOTE: 4113884095 - 5,000 kgs (200 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

711574 - Cultura de microrganismos liofilizados ((Streptococcus thermophilus, Lactobacillus delbrueckii subsp. Bulgaricus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - FD-DVS SA 500- Cada cx con
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

621208 - Cultura de microrganismos liofilizados (Debaryomyces hansenii, Lactobacillus sakei, Pediococcus pentosaceus, Staphylococcus xylosus e Staphylococcus carnosus empregada como fermento em produtos embutidos nas indústrias frigorificas - Bactofe
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08H5802 CELL-DYN 29 PLUS CONTROL (WITH RETIC) - CELL-DYN 29 PLUS CONTROLE (COM RETIC) APRESENTACAO: 6 FRASCOS X 3,0 ML (CADA) CELL-DYN 29 PLUS CONTROL (WITH RETIC) / CELL-DYN 29 PLUS CONTROLE (COM RETIC) PODEM CONTER ERITROCITOS HUMANOS OU DE MAMIFER
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1277838 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO : NOME COMERCIAL: CHOOZIT SWIFT 516 FRO 750 DCUDESCRICAO: Caracteriza-se como cultura congelada de microrganismos, mais particularmente como culturas de Streptococcus thermophilus altament
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

IMUNOENSAIO PARA DETERMINACAO QUANTITATIVA IN VITRO DA TROPONINA T CARDIACA EM SORO E PLASMA HUMANOS FAMILIA ELECSYS TROPONIN T HS TROPONIN T HS ELECSYS COBAS E 200 V2 P/N: 08469717190 APRESENTACAO: ELECSYS TROPONIN T HS - 200 TESTES - M 12ML R1 14ML
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704638 - Cultura de microrganismos congelados (Streptococcus thermophilus e Lactococcus lactis subsp) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS RST-676 10 x 500U - cada caixa contém 10
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6122 FAMILIA ALINITY I RHTLV-I/II APRESENTACAO.: ALINITY I RHTLV-I/II REAGENT KIT - MICROPARTICULAS: 2 X 6,6 ML/CONJUGADO: 2 X 6,1 ML/DILUENTE DE ENSAIO: 2 X 8,0 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE PEPTIDEO SINTETICO DO HTLV-I/HTLV-I
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS L.ACIDOPHILUS 10B STD FOS CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/ANATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA-
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SISTEMA INDIRETO PARA DETETAR ALVOS MARCADOS COM DIG. O KIT DESTINA-SE A IDENTIFICAR ALVOS POR HIBRIDIZACAO IN SITU (ISH). EM GERAL, A ISH UTILIZA SONDAS MARCADAS PARA DETETAR SEQUENCIAS ALVO ESPECIFICAS DE DNA OU RNA EM SECOES DE TECIDO FIXADAS. FAM
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISAS CIENTIFICAS E TECNOLOGICAS NAO TERA USO MEDICO-ODONTO-HOSPITALAR HUMANO OU NA AGROPECUARIA: 07 COD: 10437028 SORO FETAL BOVINO, QUALIFICADO, 500 ML, LOTE: 2211703RP VALIDADE: 30/03/25. ORIGEM MEXICO.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704637 - Cultura de microrganismos congelados (Streptococcus thermophilus e Lactococcus lactis subsp) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS RST-643 10X500U - cada caixa contem 10 en
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SISTEMA INDIRETO PARA DETECTAR ALVOS MARCADOS COM DNP. O KIT DESTINA-SE A IDENTIFICACAO DE ALVOS ATRAVES DE HIBRIDIZACAO IN SITU (ISH). EM GERAL, A HIBRIDIZACAO IN SITU (ISH) UTILIZA SONDAS COM MARCACAO PARA DETETAR SEQUENCIAS ALVO ESPECIFICAS DE DNA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

09P1932 ALINITY I CHAGAS APRESENTACAO: ALINITY I CHAGAS REAGENT KIT - MICROPARTICULAS: 2 X 27 ML / CONJUGADO: 2 X 26,5 ML / DILUENTE DE ENSAIO: 2 X 47,1 ML MICROPARTICULAS RECOBERTAS COM ANTIGENOS RECOMBINANTES DE T CRUZI (FP3, FP6, FP10 E TCF) EM TA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CULTURA DE MICROORGANISMOS UTILIZADA COMO MATERIA PRIMA PARA FABRICAÇÃO DO PRODUTO BIOLÓGICO ENZILIMP, REGISTRO ANVISA: 323850008. NOME COMERCIAL: BIOREMOVE FOG, MARCA COMERCIAL: NOVOZYMES BIOLOGICAL INC. LOTE NUMERO: 102D501; 104D543. SENDO: BIOREMO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90418 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO : NOME COMERCIAL: YO-MIX 883 LYO 250 DCUDESCRICAO: Uma Mistura de cepas definidas de bacterias lacticas para inoculacao direta no leite e produtos a base de leite. A cu
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90649 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: TEXELDESCRICAO: Trata-se de uma cultura de maturacao liofilizada, desenvolvida especialmente para texturizacao, aromatizacao e coloracao de preparados
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

717224 - Culturas de microrganismos liofilizados (Lactobacillus rhamnosus), empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - FD-DVSFreshQ® 9 - Cada caixa contém 25 envelopes.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

70200763566 Fatura: 9233036279 P.O./It 21095962/0001 INDICADOR BIOLOGICO COMPOSTO POR AMPOLA CONTENDO ESPOROS DOGEOBACILLUS STEAROTHERMOPHILUS COM UMA POPULACAO MINIMA DE 1X105 ESPOROS POR TIRA PARA SER UTILIZADO EM MONITORAMENTO DECICLOS DE ESTERILI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS REUTERI CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/A NATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA-PRIMATEMPERATURA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO YOG FVV-122 DSF 2U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. 606484/30 - prod. 21/04/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS L.CASEI 10B STD FOS CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/A NATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA-PRIMA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 121,DSF, 5U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. GT00048536 - prod. 30
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: SRP300 - KIT ELISA DE ADIPONECTINA/ACRP30 QUANTIKINE TOTAL HUMANA, 6 PLACAS, COMPOSTO POR: - MICROPLACA ADIPONECTINA HUMANA ? 06 PLACAS - PADRÃO DE ADIPONECTINA HUMANA - 12 FRASCOS- ADIPONECTIN
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CULTURA DE MICROORGANISMOS UTILIZADA COMO MATERIA PRIMA PARA FABRICAÇÃO DO PRODUTO BIOLÓGICO ENZILIMP, REGISTRO ANVISA: 323850008. NOME COMERCIAL: BIOREMOVE COD, MARCA COMERCIAL: NOVOZYMES BIOLOGICAL INC. LOTE NUMERO: 031D027; 039D154. SENDO: BIOREMO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANATOXINA DIFTERICA - USO E FINALIDADE: O PRESENTE PRODUTO TRATA-SE DE AMOSTRA PARA TESTE DE BANCADA, SER? UTILIZADO NO DESENVOLVIMENTO DE UM ANT?GENO SINT?TICO, ELA FUNCIONAR? COMO PROTEÍNA CARREGADORA E SER? CONJUGADA A UM PEPTÍDEO. LOTE: ARMPCD 16
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE NEGATIVO E POSITIVO PARA UTILIZACAO COM O ENSAIO ANTI-SARS-COV-2 (COVID-19). O CONTROLE PRECICONTROL ANTI SARS COV 2 E UM SORO DE CONTROLE PRONTO A UTILIZAR BASEADO EM SORO HUMANO. OS CONTROLES SAO UTILIZADOS PARA MONITORIZAR A EXATIDAO DO I
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: S8000C - KIT ELISA DE INTERLEUCINA-8 (IL-8) / CXCL8 QUANTIKINE HUMANA, 01 PACOTE COM 6 PLACAS, COMPOSTO POR: - MICROPLACA DE IL-8 HUMANA - PN: 890462 - 6 PLACAS- PADRÃO DE IL-8 HUMANA - PN: 890
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS REUTERI CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/A NATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA-PRIMATEMPERATURA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: PROTEÍNA DE TOXINA SHIGA LIOFILIZADA ALTAMENTE PURIFICADA PARA SER USADA EM PESQUISAS MÉDICAS - 5MG
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

13541065 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: HOLDBAC LC LYO 500 DCUDESCRICAO: Cultura protectiva homofermentativa com acidificacao muito lenta, forma acido lactico do tipo L (+) e decompoe peq
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90785 - CULTURA DE MICROORGANISMOS, FERMENTO, MARCA COMERCIAL: YO-MIX Yogurt Cultures DESCRICAO: Trata-se de um produto farmaceutico, caracterizando-se como culturas de microrganismos e,mais particularmente, como culturas Streptococcus thermophillus
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1279947 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: CHOOZIT SWIFT 522 FRO 750 DCU.DESCRICAO: CULTURA CONGELADA DE STREPTOCOCCUS THERMOPHILUS ALTAMENTE CONCENTRADA, DE RAPIDA ACIDIFICACAO, FORMANDO ACIDO LACTICO TIPO L(+).CH
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

7000002632 / 70200620527 / 95945 / 001 - CULTURA DE MICROORGANISMOS. INDICADOR BIOLOGICO, CONTENDO CULTURA DE MICROOORGANISMOS (B.STEAROTHERMOPHILUS) EM TIRAS DEPAPEL DE FILTRO, ARMAZENADAS EM FRASCOS PLASTICOS, UTILIZADO PARA MONITORAR ESTERILIZACAO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1287516 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL : YO-MIX T 21 FRO 500 DCU DESCRICAO: CULTURAS LACTECAS CONGELADAS EM PALLETS PARA INOCULACAO DIRETA EM LEITE. LOTE: 4113844698 - 135,000 kgs (300 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

701877 - Cultura de microrganismos liofilizados (Mistura de culturas mesófilas e termófilas) empregada como fermento lácteo na preparação de derivados de leite FD-DVS RST-776 - cada caixa contem 25 ev.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

STREPTOC.THERMOPHILUS(PROBIOTICS POWDER) CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/ANATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SORO DE CONTROLE LIOFILIZADO BASEADO EM SORO HUMANO, UTILIZADO PARA O CONTROLE DE QUALIDADE DE IMUNOENSAIOS ELECSYS HTLV-I/II NOS ANALISADORES DE IMUNOENSAIO COBAS E PRECICONTROL HTLV HTLV PC ELECSYS P/N: 07108133190 APRESENTACAO PC HTLV 0 2 X 1.0ML
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS PARACASEI(PROBIOTICS POWDER) CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/ANATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATER
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LÁCTEO B830 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 10 U IDC (LACTOFERM B830 DRY STARTERS) - LOTE: M2308F - DATA DE FABRICAÇÃO: 06/04/202
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PLASMA HUMANO NORMAL CITRATADO EM POOL, PARA CALIBRACAO DE ENSAIOS DE COAGULACAO SELECCIONADOS NOS EQUIPAMENTOS ANALISADORES COBAS T INDICADOS CAL PLASMA CALIBRATOR PLASMA COBAS T411 (10X1ML) P/N: 07141904190 APRESENTACAO: 10 x 1ML CONDICAO DO PRODUT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

13541063 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: HOLDBAC LC LYO 100 DCU DESCRICAO: Cultura liofilizada Cultura de cepa unica termofilica LOTE: 4113878928 - 10,000 kgs (1000 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

7100208295 / 70201177857 / 96242 / 001 - PACOTE TESTE DESAFIO MODELO 41482VF. UTILIZADO NO PROCESSO DE ESTERILIZACAO POR VAPOR NA AREA DA SAUDE. COMPOSTO COM UM INTEGRADOR QUIMICO STERIGAGE E UM INDICADOR BIOLOGICO (GEOBACILLUS STEAROTHERMOPHILUS) DE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90775 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZIT DESCRICAO: Trata-se de um produto farmaceutico, caracterizando-se como culturas de microrganismos e,mais particularmente, como culturas de Str
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1277836 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: CHOOZIT SWIFT 514 FRO 750 DCUDESCRICAO: Caracteriza-se como cultura congelada de microrganismos, mais particularmente como culturas de Streptococcus thermophilus altamente
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704645 - Cultura de microrganismos congelado (Streptococcus thermophilus Lactobacillus helveticus Lactococcus lactis subsp) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) F-DVS RSF-636 - cada caixa
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90776 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZIT DESCRICAO: Trata-se de um produto farmaceutico, caracterizando-se como culturas de microrganismos e,mais particularmente, como culturas de Str
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM B830 - FERMENTO LÁCTEO B830 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 10U IDC - LOTE: M2250G DATA DE FABRICAÇÃO: 08/02/2021 - DATA DE VALI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

T3694-10UG - Codigo do item: T3694-10UG, Nome Comercial: Fragmento C da toxina do tetano deClostridium tetani, Sinonimos: TTC, Forma de uso: pesquisaa e desenvolvimento(R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com10 m
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90581 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: YO-MIXDESCRICAO: Mistura de cepas definidas de bacterias lacticas, para a inoculacao direta no leite e produtos a base de leite, apresentada em po lio
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6022 FAMILIA ALINITY I SYPHILIS TP APRESENTACAO: ALINITY I SYPHILIS TP REAGENT KIT - MICROPARTICULAS:2 X 4,2 ML/CONJUGADO: 2 X 4,2 ML/DILUENTE DE ENSAIO: 2 X 5,9 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO TP (E.COLI, RECOMBINANTE)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704645 - Cultura de microrganismos congelado (Streptococcus thermophilus Lactobacillus helveticus Lactococcus lactis subsp) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) F-DVS RSF-636 - cada caixa
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

714793 - Cultura de microrganismo congelado (Lactobacillus paracasei) empregada como fermento lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS FreshQ 5 - Cada caixa contém 20 envelopes.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM LLCST 250 U IDC - ROTACAO 5, CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306C.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM LLCST 250 U IDC, ROTACAO 2 CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306A.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM LLCST 250 U IDC - ROTACAO 4 CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306B.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM LLCST 250 U IDC, ROTACAO 6 CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306D.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISAS CIENTIFICAS E TECNOLOGICAS - NAO TERA USO MEDICO-ODONTO-HOSPITALAR HUMANO OU NA AGROPECUARIA:01 CAT: LVS(VB201112-1075huc)-C REMCOMBINANTE LENTIVIRUS, SERVICO DE EMBALAGEM EM ESCALA PILOTO LENTIVIRUS PARA: pLVÝE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P8722 FAMILIA ALINITY I ANTI-HBC II APRESENTACAO.: ALINITY I ANTI-HBC II REAGENT KIT - MICROPARTICULAS: 2 X 4,2 ML/CONJUGADO: 2 X 8,7 ML/ DILUENTE DE ENSAIO: 2 XDE 5,9 ML/DILUENTE DE AMOSTRA: 2 X 4,2 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS D
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6132 FAMILIA ALINITY I RHTLV-I/II APRESENTACAO: ALINITY I RHTLV-I/II REAGENT KIT - MICROPARTICULAS: 2 X 27,0 ML/CONJUGADO: 2 X 26,5 ML/DILUENTE DE ENSAIO: 2 X 35,4 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE PEPTIDEO SINTETICO DO HTLV-I/HTLV
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM MST 250 U IDC, ROTACAO 5, CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306F.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM MST 250 U IDC, ROTACAO 4 CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306E.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS ACIDOPHILUS(PROBIOTICS POWDER) CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/ANATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MAT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50379 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO.: MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em env
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704642 - Cultura de microrganismos congelados (Lactococcus lactis subsp. Lactis) empregadA como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS BS-10 - Cada caixa contem 10 ev.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (TOM F-05 1 - 25 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (TOM F-05 4 - 25 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (TOM F-05 5 - 25 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (TOM F-05 3 - 25 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LÁCTEO B830 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 100 U IDC (LACTOFERM B830 DRY STARTERS) - LOTE: M2308E - DATA DE FABRICAÇÃO: 06/04/20
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS GASSERI 100G/BAG - 700BAG CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/ANATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA-
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM ST 250 U IDC , ROTACAO 11, CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306M.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

714793 - Cultura de microrganismo congelado (Lactobacillus paracasei) empregada como fermento lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS FreshQ 5 - Cada caixa contém 20 envelopes.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

714793 - Cultura de microrganismo congelado (Lactobacillus paracasei) empregada como fermento lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS FreshQ 5 - Cada caixa contém 20 envelopes.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90681 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada para inoculacao direta em leite ou produtos a base de leite. Trata-se mistura concentrada de
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

714793 - Cultura de microrganismo congelado (Lactobacillus paracasei) empregada como fermento lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS FreshQ 5 - Cada caixa contém 20 envelopes.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

714793 - Cultura de microrganismo congelado (Lactobacillus paracasei) empregada como fermento lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS FreshQ 5 - Cada caixa contém 20 envelopes.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS L.RHAMNOSUS 10B CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/A NATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA-PRIMATEMP
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P8732 FAMILIA ALINITY I ANTI-HBC II APRESENTACAO: ALINITY I ANTI-HBC II REAGENT KIT - MICROPARTICULAS: 2 X 16,8 ML/ CONJUGADO: 2 X 17,8 ML/DILUENTE DE ENSAIO: 2X 15,3 ML/DILUENTE DE AMOSTRA: 2 X 15,1 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM ST 250 U IDC , ROTACAO 12, CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306N.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM ST 250 U IDC - ROTACAO 13, CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306O.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE UTILIZADO PARA FAZER VERIFICACOES DE CONTROLE DE QUALIDADE DE ENSAIOS DE COAGULACAO ESPECIFICADOS NOS EQUIPAMENTOS ANALISADORES DE COAGULACAO COBAS T FAMILIA DE CONTROLES T411 CONTROL 2 COBAS T411 (20X1ML) P/N: 07105339190 APRESENTACAO: CONT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

100259 - Cultura de microrganismos liofilizados (Lactobacillus delbrueckii subsp. bulgaricus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS YC-380 - Cada caixa c
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CP 502, 10U Descri Æo do produto: Culturas congeladas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. GT00048077 - prod. 18/02
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM YO-442 250 U IDC, CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306U.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM YO-440 250 U IDC, CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306T.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

IMUNOENSAIO PARA DETERMINACAO QUANTITATIVA IN VITRO DA TROPONINA T CARDIACA EM SORO E PLASMA HUMANOS FAMILIA ELECSYS TROPONIN T HS TROPONIN T HS ELECSYS COBAS E 200 V2 P/N: 08469717190 APRESENTACAO: ELECSYS TROPONIN T HS - 200 TESTES - M 12ML R1 14ML
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS ACIDOPHILUS(PROBIOTICS POWDER) CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/ANATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MAT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

3459 PNEUMOCOCCAL CWPS (CELL WALL POLYSACCHARIDE) - 10 MG MICROORGANISMO CEPAS (BACTERIAS) UTILIZADAS PARA TESTES SOROLOGICOS PARA PESQUISA DE ANTICORPOS ANTI-STREPTOCOCUS PNEUMONIA E DE USO EXCLUSIVO DO FLEURY. SAO ANTIGENOS LIOFILIZADOS DE POLISSAC
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LÁCTEO B450 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 25U IDC (LACTOFERM B450 DRY STARTERS) - LOTE: M2308A-R13 - DATA DE FABRICAÇÃO: 06/04/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM MST 250 U IDC, ROTACAO 6, CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306G.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

717796 - Culturas de microrganismos congeladas (.Lactobacillus rhamnosus e Lactococcus lactis subsp. cremoris), empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS DN910002 - Cada caixa contém 10
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704634 - Cultura de microrganismos congelados (Lactococcus lactis subsp. Lactis e Lactococcus lactis subsp. Cremoris) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS r-604 10X500U - cada caix
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM B450 - FERMENTO LÁCTEO B450 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 25U IDC - LOTE: M2250C-R13 DATA DE FABRICAÇÃO: 08/02/2021 - DATA DE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1281183 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: CHOOZIT SWIFT 526 FRO 750 DCU CULTURA CONGELADA DE STREPTOCOCCUS THERMOPHILUS ALTAMENTE CONCENTRADA, DE RAPIDA ACIDIFICACAO, FORMANDO ACIDO LACTICO TIPO L(+).CHOOZIT SWIFT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

712989 - Cultura de microrganismos liofilizados (Lactobacillus sakei, Pediococcus acidilactici, Pediococcus pentosaceus, Staphylococcus carnosus e Staphylococcus xylosus) empregada como fermento em produtos embutidos nas indústrias frigorificas - Saf
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

366 FROM 12.03.2021 - Cultura bacterial ( Lactobacillus rhammosus, Lactoccous lactis ssp. lactis, Propionibacterium freudenreichi spp.) oncentrada linha perfil PC 27.50 - P/N PC275050AU, (50 AU) - LOTE:366 Nome Comercial: Golden Line ProfilineEspecif
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

100259 - Cultura de microrganismos liofilizados (Lactobacillus delbrueckii subsp. bulgaricus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS YC-380 - Cada caixa c
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50589 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: YO-MIX 495 LYO 250 DCU DESCRICAO: Misturas de cepas de bacterias laticas selecionadas para inoculacao direta em leite e outros alimentos.LOTE: 44938446
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS SALIVARIUS CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/A NATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA-PRIMATEMPERATU
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CULTURA DE MICROORGANISMOS UTILIZADA COMO MATERIA PRIMA PARA FABRICAÇÃO DO PRODUTO BIOLÓGICO ENZILIMP, REGISTRO ANVISA: 323850008. NOME COMERCIAL: GREASE GUARD D LIPASE, MARCA COMERCIAL: NOVOZYMES BIOLOGICAL INC. LOTE NUMERO: 053D344. SENDO: GREASE G
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE NEGATIVO E POSITIVO PARA UTILIZACAO COM O ENSAIO ANTI-SARS-COV-2 (COVID-19). O CONTROLE PRECICONTROL ANTI SARS COV 2 E UM SORO DE CONTROLE PRONTO A UTILIZAR BASEADO EM SORO HUMANO. OS CONTROLES SAO UTILIZADOS PARA MONITORIZAR A EXATIDAO DO I
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

09P1001 FAMILIA ALINITY I HBEAG APRESENTACAO.: ALINITY I HBEAG QUANTITATIVE CALIBRATORS - 6 X 3,0 ML CALIBRADOR A: CONTEM TAMPAO TRIS COM ESTABILIZANTE DE PROTEINA (BOVINA). CONSERVANTES: AZIDA SODICA E AGENTES ANTIMICROBIANOS. CALIBRADOR B-F: CONTEM
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 315-03 - RECOMBINANTE GM-CSF MURINO - 500UG - LOTE: 091855 C2420
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704645 - Cultura de microrganismos congelado (Streptococcus thermophilus Lactobacillus helveticus Lactococcus lactis subsp) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) F-DVS RSF-636 - cada caixa
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

11393063 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: Probat 222 LYO 100 DCUDESCRICAO : Probat 222 LYO 100 DCU apresenta-se na forma liofilizada e trata-se de uma cultura de microrganismos, mais particu
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-MOT4 -50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES MOT4 50 DOSI - M330 - 50U LOTE: 0321542 - DATA DE FABRICAÇÃO: 16/03/2021- DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-MOT1 -50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES MOT1 50 DOSI - M330 - 50U LOTE: 0321539 - DATA DE FABRICAÇÃO: 16/03/2021- DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-MOT3 -50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES MOT3 50 DOSI - M330 - 50U LOTE: 0321541 - DATA DE FABRICAÇÃO: 16/03/2021- DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-MOT2 -50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES MOT2 50 DOSI - M330 - 50U LOTE: 0321540 - DATA DE FABRICAÇÃO: 16/03/2021- DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLES UTILIZADOS PARA FAZER VERIFICACOES DO SISTEMA E TESTES DE CONTROLE DE QUALIDADE DO TEMPO DE TROMBOPLASTINA PARCIAL ACTIVADA (APTT) COM O APARELHO COAGUCHEK PRO II E FAMILIA COAGUCHEK APTTCOAGUCHEK APTT CONTROLS (LEVEL 1 + 2)P/N: 06882692190
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704787 - Culturas de microrganismos congelados (Lactococcus lactis subsp. cremoris, Lactococcus lactis subsp. lactis, Lactococcus lactis subsp. lactis biovar. diacetylactis e Leuconostoc) empregadas como fermento lácteo na preparação de derivados de
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704746 - Cultura de microrganismos congelados (Lactobacillus delbrueckii subsp. bulgaricus e Streptococcus thermophilus)empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS DN SYNERGY - Cada caixa
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704746 - Cultura de microrganismos congelados (Lactobacillus delbrueckii subsp. bulgaricus e Streptococcus thermophilus)empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS DN SYNERGY - Cada caixa
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

11393063 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: Probat 222 LYO 100 DCUDESCRICAO : Probat 222 LYO 100 DCU apresenta-se na forma liofilizada e trata-se de uma cultura de microrganismos, mais particu
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SISTEMA INDIRETO PARA DETECTAR ALVOS MARCADOS COM DNP. O KIT DESTINA-SE A IDENTIFICACAO DE ALVOS ATRAVES DE HIBRIDIZACAO IN SITU (ISH). EM GERAL, A HIBRIDIZACAO IN SITU (ISH) UTILIZA SONDAS COM MARCACAO PARA DETETAR SEQUENCIAS ALVO ESPECIFICAS DE DNA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

TOXOIDE DIFTERIA PARA USO EM TESTE DE LOCULACAO (3RD INTERNATIONAL STANDARD) - 13/212 NR. DE LOTE: 13/212
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50385 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO.: MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em env
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

336 FROM 10.03.2021 - Cultura bacterial ( Streptococcus salivarius ssp. thermophilus Lactobacillus delbrueckii ssp. bulgaricus) concentrada linha perfil YO 22.50 LOW - P/N YO2250LOW50AU¨, (50 AU) - LOTE:336 Nome Comercial: Golden Line ProfilineEspeci
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1279861 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO : NOME COMERCIAL: CHOOZIT SWIFT 524 FRO 750 DCU.DESCRICAO: CULTURA CONGELADA DE STREPTOCOCCUS THERMOPHILUS ALTAMENTE CONCENTRADA, DE RAPIDA ACIDIFICACAO, FORMANDO ACIDO LACTICO TIPO L(+).
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50588 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: YO-MIX 495 LYO 100 DCU DESCRICAO: Misturas de cepas de bacterias laticas selecionadas para inoculacao direta em leite e outros alimentos.LOTE: 44938446
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50539 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em sache
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

76607 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: YO-MIX 499 LYO 100 DCU.DESCRICAO: Trata-se de uma mistura de cepas definidas de bacterias lacticas para a inoculacao direta no leite e produtos a base
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6122 FAMILIA ALINITY I RHTLV-I/II APRESENTACAO.: ALINITY I RHTLV-I/II REAGENT KIT - MICROPARTICULAS: 2 X 6,6 ML/CONJUGADO: 2 X 6,1 ML/DILUENTE DE ENSAIO: 2 X 8,0 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE PEPTIDEO SINTETICO DO HTLV-I/HTLV-I
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

681930 - Cultura de microrganismos liofilizados (Lactobacillus sakei e Lactobacillus sakei, Staphylococcus carnosus e Staphylococcus xylosus) empregada como fermento em produtos embutidos nas indústrias frigorificas - Bactoferm® FAST 301 - Cada caixa
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

Cultura de micro-organismos, cultura de bacterias apresentada em saches, na forma de po. Materia-prima destinada a comercializacao a farmacias magistrais para a manipulacao de preparacoes magistrais dispensadas sob prescricao de profissional legalmen
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

01 X COD.0710-1325 PADRAO DE REFERENCIA DE GDNA TMB 2X500NG
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EM LABORATORIO DE ANALISES E PESQUISAS, NAO TERA USO MEDICO-ODONTO-HOSPITALAR HUMANO OU NA AGROPECUARIA: 01 X COD.0710-1586 PADRAO DE REFERENCIA DE GDNA TMB 2X10UL
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EM LABORATORIO DE ANALISES E PESQUISAS, NAO TERA USO MEDICO-ODONTO-HOSPITALAR HUMANO OU AGROPECUARIA: 01 X COD.0710-1324 PADRAO DE REFERENCIA DE GDNA TMB 2X500NG
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

339 FROM 10.03.2021 - Cultura bacterial ( Streptococcus salivarius ssp. thermophilus Lactobacillus delbrueckii ssp. bulgaricus) concentrada linha perfil YO 22.60 - P/N YO226050AU, (50 AU) - LOTE:339 Nome Comercial: Golden Line ProfilineEspecificacao
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

722668 - Cultura de microrganismo liofilizado (Lactobacillus rhamnosus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - FD-DVS FreshQ® 11 - cada caixa contém 25 envelopes de 100u.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO BY220 UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 50U IDC (LACTOFERM BY220) - LOTE: M2308H - DATA DE FABRICAÇÃO: 06/04/2021 - DATA DE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM B460 - FERMENTO LÁCTEO B320 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 50U IDC - LOTE: M2250A-R8 DATA DE FABRICAÇÃO: 08/02/2021 - DATA DE V
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM B320 - FERMENTO LÁCTEO B320 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 50U IDC - LOTE: M2250B-R4 DATA DE FABRICAÇÃO: 08/02/2021 - DATA DE V
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1261266 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO. SENDO: NOME COMERCIAL: HOWARU DOPHILUS LYO 10 DCU-SDESCRICAO: HOWARU DOPHILUS LYO 10 DCU-S trata-se de um fermento lacteo em veiculo de dextrose caracterizando-se como uma
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

13264032 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS. SENDO: NOME COMERCIAL: PROBAT 404 FRO 500 DCU DESCRICAO: Cultura concentrada congelada, na forma de pellets para inoculacao direta no leite. Cultura mesofilica DL de cepas miltiplas, complexa.E
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1253183 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCAR COMERCIAL: HOLDBACDESCRICAO: Cultura com acidificacao muito lenta e baixa, formando acido lactico do tipo (L+), acido acedtico e acido propionico. E utilizado
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CULTURA DE MICROORGANISMOS UTILIZADA COMO MATERIA PRIMA PARA FABRICAÇÃO DO PRODUTO BIOLÓGICO ENZILIMP, REGISTRO ANVISA: 323850008. NOME COMERCIAL: ODOR CAP 5700, MARCA COMERCIAL: NOVOZYMES BIOLOGICAL INC. LOTE NUMERO: 044D232. SENDO: ODOR CAP 5700 (1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: Cod VR-648-ATCC virus da panleucopeia felina 1 ml Formato do produto congelado Armazenamento menos 70 C ou mais frio bsl2
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LÁCTEO B450 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 25U IDC (LACTOFERM B450 DRY STARTERS) - LOTE: M2308C-R15 - DATA DE FABRICAÇÃO: 06/04/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LÁCTEO B450 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 25U IDC (LACTOFERM B450 DRY STARTERS) - LOTE: M2308b-R16 - DATA DE FABRICAÇÃO: 06/04/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LÁCTEO B450 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 25U IDC (LACTOFERM B450 DRY STARTERS) - LOTE: M2308B-R14 - DATA DE FABRICAÇÃO: 06/04/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

IMUNOENSAIO PARA DETERMINACAO QUANTITATIVA IN VITRO DA TROPONINA T CARDIACA EM SORO E PLASMA HUMANOS. FAMILIA ELECSYS TROPONIN T HS TROPONIN T HS ELECSYS E2G 300 V2 P/N: 08469873190 APRESENTACAO: ELECSYS TROPONIN T HS - 300 TESTES - M 12,4ML R1 15,8M
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 001415-050 - RECOMBINANTE HUMANO DE FLT-3L RH, GMP E GRAU PRÉ-CLÍNICO CELLGENIX® - 50UG - LOTE: 1415ID34
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 001417-050 - RECOMBINANTE HUMANO DE TPO RH, GMP E GRAU PRÉ-CLÍNICO CELLGENIX® - 50UG - LOTE: 1417RF11
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 001402-050 - RECOMBINANTE HUMANO DE INTERLEUCINA-3 (IL-3) RH, GMP E GRAU PRÉ-CLÍNICO CELLGENIX® - 50UG - LOTE: 1402LD12
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 001404-050 - RECOMBINANTE HUMANO DE INTERLEUCINA-6 (IL-6) RH, GMP E GRAU PRÉ-CLÍNICO CELLGENIX® - 50UG - LOTE: 1404GB14
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 001418-050 - RECOMBINANTE HUMANO DE SCF RH, GMP E GRAU PRÉ-CLÍNICO CELLGENIX® - 50UG - LOTE: 1418LG22
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM B450 - FERMENTO LÁCTEO B450 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 25U IDC - LOTE: M2250D-R14 DATA DE FABRICAÇÃO: 08/02/2021 - DATA DE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM B450 - FERMENTO LÁCTEO B450 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 25U IDC - LOTE: M2250E-R15 DATA DE FABRICAÇÃO: 08/02/2021 - DATA DE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

368 FROM 15.03.2021 - Cultura bacterial ( Streptococcus salivarius ssp. thermophilus Lactobacillus helveticus) concentrada linha ouro CH 4.05 M - P/N CH405250AU, (250 AU) - LOTE:368 Nome Comercial: Golden Line Goldem Time;Especificacao Tecnica: TU 10
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50382 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO NOME COMERCIAL: CHOOZIT RA 22 LYO 250 DCU DESCRICAO: Cultura latica liofilizada para inoculacao direta em leite ou produtos a base de leite.LOTE: 4493832127 - 3,040 kgs
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50590 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: YO-MIX 496 LYO 250 DCU DESCRICAO: Misturas de cepas de bacterias laticas selecionadas para inoculacao direta em leite e outros alimentos.LOTE: 44938459
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50543 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em sache
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56011 - A.BRASILIENSIS (NIGER) 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6182
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

13541063 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: HOLDBAC LC LYO 100 DCU DESCRICAO: Cultura liofilizada Cultura de cepa unica termofilica LOTE: 4113865363 - 3,500 kgs (500 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

13930073 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: P. roqueforti PV LYO 10 D DESCRICAO: Cultura liofilizada para inoculacao direta em leite. LOTE: 4113841488 - 0,490 kgs (70 EA)LOTE: 4113850560 - 0,1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: Cod VR-2057-ATCC Calcivirus felino cepa FCV2280 1ml Formato do produto congelado Armazenamento em menos 70 ou mais frio Bsl 2
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: Cod VR-636-ATCC Herpesvirus felideo 1 1ml Formato do produto congelado Armazenamento a menos 60 o mais frio bsl 2
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90984 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em sache
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FRASCO COM 1ml. DE PARACOCCIDIONE ID ANTIGENO, PARA USO INDUSTRIAL, CODIGO: PI0110.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50396 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em saches multifol
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

328 FROM 10.03.2021 - Cultura bacterial ( Streptococcus salivarius ssp. thermophilus), concentrada linha ouro CH 4.04 M - P/N CH404M250AU, (250 AU) - LOTE:328: Nome Comercial: Golden Line Goldem Time;Especificacao Tecnica: TU 10.89.19-025-51070597-20
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

REAGENTE 2 (ML LDL-C R2) PARA DETERMINACAO DIRETA E HOMOGENEA DO COLESTEROL DA LIPOPROTEÍNA DE BAIXA DENSIDADE (LDL) - REF.:59346 (BULK 5L), 59348 (BULK 10L) E 58963-1 (KIT) 58957 (KIT 300mLX4).REGISTRO ANVISA:10009010333 - 059346 - ML LDL-C R-2 5LT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 130-095-130 - KIT REAGENTE DE ISOLAMENTO DE CÉLULAS PAN T II, PRODUZIDO EM CAMUNDONGO, COMPOSTO POR:- 1 ML DE COQUETEL DE BIOTINA-ANTICORPO DE CÉLULAS PAN T, PRODUZIDO EM CAMUNDONGO: COQUETEL D
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-LHT/G2-50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES LHT/G2 50 DOSI - M423 - 50U - LOTE: 0321548 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/20
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-LHT/G1-50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES LHT/G1 50 DOSI - M423 - 50U - LOTE: 0321547 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/20
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-LHT/G3-50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES LHT/G3 50 DOSI - M423 - 50U - LOTE: 0321549 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/20
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-LHT/G4-50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES LHT/G4 50 DOSI - M423 - 50U - LOTE: 0321550 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/20
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

13850063 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: HOLDBAC YM-B LYO 100 DCU. DESCRICAO: Cultura Liofilizada. Cultura de multiplas especies definidas. LOTE: 4113853672 - 1,800 kgs (200 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CC-302, 5U Descricao do produto: Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. GT00048275 - prod. 25/02/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CC-301, 5U Descricao do produto: Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. GT00047909 - prod. 24/02/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CC-306, 5U Descricao do produto: Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. GT00048286 - prod. 05/03/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

NATSARSCOV2-ST - PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: REAGENTE CONTROLE PARA DETECCAO DE SARSCOV2 2UNI -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

NATSARSCOV2-ST - PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: REAGENTE CONTROLE PARA DETECCAO DE SARSCOV2 2UNI -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM LLCDET 250 U IDC - ROTACAO 4, CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306H.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM LLCDET 250 U IDC - ROTACAO 5, CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306I.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM LLCDET 250 U IDC - ROTACAO 6, CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306L.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

100123 - Cultura de microrganismos liofilizados (Lactococcus lactis subsp. Lactis e Lactococcus lactis subsp. cremoris) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - FD-DVS R-704 - cada caixa con
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DAYTEC BIO PO 1000 (MEGA-BAC X - GRANULATED) - EMBALAGEM COM 100 (CEM) BALDES DE POLIETILENO DE ALTA DENSIDADE (PEAD), COM CAPACIDADE DE 5 KILOS POR UNIDADE. TIPO DE FORMULACAO: PO DE ASPECTO GRANULADO DE COLORACAO MARROM, ODOR CARACTERISTICO DE CULT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 130-125-835 - REAGENTE IMUNOLÓGICO DE MICROESFERAS ULTRAPURE DO MARCADOR CD11C, PRODUZIDO EM CAMUNDONGO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1292345 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: YO-MIX T 23 FRO 500 DCU DESCRICAO: CULTURAS LACTECAS CONGELADAS EM PALLETS PARA INOCULACAO DIRETA EM LEITE LOTE: 4113793815 - 45,000 kgs (100 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

710466 - Cultura de microrganismos liofilizados (Streptococcus thermophilus, Lactobacillus delbrueckii subsp. Bulgaricus e Lactobacillus helveticus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

7100208295 / 70201177857 / 96659 / 001 - PACOTE TESTE DESAFIO MODELO 41482VF. UTILIZADO NO PROCESSO DE ESTERILIZACAO POR VAPOR NA AREA DA SAUDE. COMPOSTO COM UM INTEGRADOR QUIMICO STERIGAGE E UM INDICADOR BIOLOGICO (GEOBACILLUS STEAROTHERMOPHILUS) DE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

76608 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: YO-MIXDESCRICAO: Trata-se de uma mistura de cepas definidas de bacterias lacticas para a inoculacao direta no leite e produtos a base de leite. A cult
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PRODUTO:. DELVO CHEESE CP 126,DSF,5U (AMOSTRA) DESCRICAO DO PRODUTO: CULTURAS CONGELADAS ALTAMENTE CONCENTRADAS DE BACTERIAS PRODUTORAS DE ACIDO LATICO; FINALIDADE: UTILIZACAO NA FABRICACAO DE QUEIJOS E IOGURTES NA INDUSTRIA DE LATICINIOS;LOTE NR.: S
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PRODUTO:. DELVO CHEESE CP 125,DSF,5U (AMOSTRA) DESCRICAO DO PRODUTO: CULTURAS CONGELADAS ALTAMENTE CONCENTRADAS DE BACTERIAS PRODUTORAS DE ACIDO LATICO; FINALIDADE: UTILIZACAO NA FABRICACAO DE QUEIJOS E IOGURTES NA INDUSTRIA DE LATICINIOS;LOTE NR.: S
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P0710 FAMILIA ALINITY I HIV AG/AB COMBO APRESENTACAO.: ALINITY I HIV AG/AB COMBO CONTROLS - CONTROLE NEGATIVO: 1 X 8,0 ML/CONTROLE POSITIVO 1: 1 X 8,0 ML/CONTROLE POSITIVO 2: 1 X 8,0 ML/CONTROLE POSITIVO 3: 1 X 8,0 ML CONTROLE NEGATIVO: E PREPARADO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50377 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em saches multifol
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

13265056 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: BULK SET HM 505 LYO 1000 I DESCRICAO: Cultura liofilizada para producao de 200 - 1000 l de bulk starter (BS)Cultura mesofilica DL de cepas multiplas
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P8952 FAMILIA ALINITY I ANTI-HBS APRESENTACAO: ALINITY I ANTI-HBS REAGENT KIT - MICROPARTICULAS: 2 X 5,0 ML/CONJUGADO: 2 X 6,1 ML/DILUENTE DE AMOSTRA: 2 X 5,9 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO DE SUPERFICIE DA HEPATITE B (S
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1285068 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: HOLDBAC YM-B PLUS LYO 100 DCU. Cultura Liofilizada, CULTURAS DE MULTIPLAS ESPECIES DEFINIDAS. LOTE: 4113873163 - 4,400 kgs (400 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

BIFIDOBACTERIUM LONGUM 100G/BAG - 50BAG CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/ANATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA-
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SORO DE CONTROLE LIOFILIZADO BASEADO EM SORO HUMANO EM DOIS INTERVALOS DE CONCENTRACAO, UTILIZADO PARA O CONTROLE DA QUALIDADE DOS IMUNOENSAIOS ESPECIFICADOS NOS ANALISADORES DE IMUNOENSAIOS ELECSYS E COBAS E. FAMILIA IGF-1 PRECICONTROL GROWTH ELECSY
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1285069 - OUTS.CULTURAS D/MICR.PRODUTOS SEMELHANTES SENDO; NOME COMERCIAL: HOLDBAC YM-B Plus FRO 500 DCU DESCRICAO: Cultura concentrada e congelada em forma de pellets para inoculacao direta. Culturas de multiplas especies definidas.EMBALAGEM: Sachet
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

Cultura de micro-organismos, cultura de bacterias apresentada em saches, na forma de po. Materia-prima destinada a comercializacao a farmacias magistrais para a manipulacao de preparacoes magistrais dispensadas sob prescricao de profissional legalmen
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

70200763566 Fatura: 9233051566 P.O./It 21096643/0001 INDICADOR BIOLOGICO COMPOSTO POR AMPOLA CONTENDO ESPOROS DOGEOBACILLUS STEAROTHERMOPHILUS COM UMA POPULACAO MINIMA DE 1X105 ESPOROS POR TIRA PARA SER UTILIZADO EM MONITORAMENTO DECICLOS DE ESTERILI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: CRL-2539-ATCC - 4T1 (ATCC® CRL-2539?) - LINHA CELULAR RESISTENTE A 6-TIOGUANINA SELECIONADA A PARTIR DO TUMOR 410.4 SEM TRATAMENTO MUTAGÊNICO, PRODUZIDO NO ORGANISMO MUS MUSCULUS, CAMUNDONGO -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

76966 PNEUMOCOCCAL POLYSACCHARIDE: PURIFIED TYPE 22F - 10MG - MICROORGANISMO UTILIZADO PARA TESTES DE SOROLOGICOS, PARA PESQUISA DE ANTICORPOS ANTIPNEUMOCOCOS DE USO EXCLUSIVO DO FLEURY. SAO LIOFILIZADOS, ACONDICIONADOS EM FRASCOS DE VIDRO, COM DIMEN
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

09P1922 ALINITY I CHAGAS APRESENTACAO: ALINITY I CHAGAS REAGENT KIT - MICROPARTICULAS: 2 X 6,6 ML / CONJUGADO: 2 X 6,1 ML / DILUENTE ENSAIO: 2 X 10,4 ML MICROPARTICULAS RECOBERTAS COM ANTIGENOS RECOMBINANTES DE T CRUZI (FP3, FP6, FP10 E TCF) EM TAMPA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50379 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO.: MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em env
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

722668 - Cultura de microrganismo liofilizado (Lactobacillus rhamnosus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - FD-DVS FreshQ® 11 - cada caixa contém 25 envelopes de 100u.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1253185 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: HOLDBAC YM-C FRO 500 DCU DESCRICAO: cultura concentrada e congelada em forma de pallets para inoculacao direta culturas de multiplas especies definidasLOTE: 4113841427 - 7
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P9310 FAMILIA ALINITY I FREE PSA APRESENTACAO: ALINITY I FREE PSA CONTROLS - CONTROLS LOW: 8ML; CONTROLS MEDIUM: 8ML; CONTROLS HIGH: 8ML OS CONTROLES CONTEM PSA (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZANTE DE PROTEINA (BOVINA). CONSERVANTES:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS PLANTARUM CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/A NATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA-PRIMATEMPERATUR
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

A14527 PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: Celulas Expi293F (EXPI293F CELLS 1ML)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

13265032 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS. SENDO: NOME COMERCIAL: Probat 505 FRO 500 DCU Cultura concentrada congelada, na forma de pellets para inoculacao direta no leite. Cultura mesofilica DL de cepas multiplas, complexa.LOTE: 411386
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

IMDA2021 - KIT CONTENDO : (3)50.00 uL DNA, (6)50.00 ug DNA EXTRAÍDODNA EXTRAÍDO - PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO.ETIQUETAS: (1)IMD101, (1)IMD102, (1)IMD103, (1)IMD201, (1)IMD202, (1)IMD203, (1)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P8957 FAMILIA ALINITY I ANTI-HBS APRESENTACAO: ALINITY I ANTI-HBS REAGENT KIT - MICROPARTICULAS: 2 X 19,9 ML/CONJUGADO: 2 X 31,6 ML/DILUENTE DE AMOSTRA: 2 X 14,7 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO DE SUPERFICIE DA HEPATITE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SEGUNDO PADRAO INTERNACIONAL - WHO - P/ IMUNGLOBULINA HUMANA ANTI-TETANO - (AMPOLA C/ 1 ML) - 13/240 NR. DE LOTE: 13/240
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56055 - STAPHYLOCOCCUS AUREUS NCTC - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6308
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

Cod: RIZOKOP - Inoculante Rizokop 3000 ml ml para tratamento de sementes de Soja (Glycine Max), CEPA Bradyrhizobium elkanii (SEMIA 587 y 5019). Embalagem: 240 frascos de 3.000 ML cada, totalizando 720 litros. Lote: 016-21-750 - Vencimento 04/09/2021.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLES UTILIZADOS PARA FAZER VERIFICACOES DO SISTEMA E TESTES DE CONTROLE DE QUALIDADE DO TEMPO DE PROTROMBINA COM O APARELHO COAGUCHEK PRO II E AS TIRAS-TESTE COAGUCHEK PT TEST STRIPS.FAMILIA COAGUCHEK PTCOAGUCHEK PT CONTROLS (LEVEL 1+2)P/N: 0667
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SORO DE CONTROLE LIOFILIZADO BASEADO EM SORO HUMANO EM DOIS INTERVALOS DE CONCENTRACAO, UTILIZADO PARA O CONTROLE DA QUALIDADE DOS IMUNOENSAIOS ESPECIFICADOS NOS ANALISADORES DE IMUNOENSAIOS ELECSYS E COBAS E. FAMILIA IGF-1 PRECICONTROL GROWTH ELECSY
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

705305 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS YoFlex Creamy 2.0 - Cada caixa contém 10ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56011 - A.BRASILIENSIS (NIGER) 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6180
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50590 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: YO-MIX 496 LYO 250 DCU DESCRICAO: Misturas de cepas de bacterias laticas selecionadas para inoculacao direta em leite e outros alimentos.LOTE: 44938674
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ENTEROCOCCUS FAECIUM CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/A NATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA-PRIMATEMPERATURA D
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MYCO CHELONAE UTILIZADO EM TESTES DE PROMOCAO DE CRESCIMENTO DOS MEIOS DE CULTURA PRODUZIDOS PELA ST. JUDE MEDICAL, SENDO ADQUIRIDO SOB A FORMA DE PELLET LIOFILIZADO. (CADA CAIXA CONTEM 5 FRASCOS). P/N: 600045247A
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50393 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em saches multifol
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: EIAM-BNP-1 - KIT BNP EIA DE MICROPLACA DE 1 X 96 TIRAS DE POÇOS, PRODUZIDO EM CAMUNDONGO, COMPOSTO POR: - MICROPLACA DE TIRA PRÉ-REVESTIDA DE 96 POÇOS - TAMPÃO DE LAVAGEM - PEPTÍDEO PADRÃO- DIL
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: EIAM-ANP-1 - KIT ANP EIA DE MICROPLACA DE 1 X 96 TIRAS DE POÇOS, PRODUZIDO EM CAMUNDONGO, COMPOSTO POR: - MICROPLACA DE TIRA PRÉ-REVESTIDA DE 96 POÇOS - TAMPÃO DE LAVAGEM - PEPTÍDEO PADRÃO- DIL
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56012 - B.SUBTILIS NCTC 10400 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6304
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56012 - B.SUBTILIS NCTC 10400 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6304
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56017 - P.AERUGINOSA NCTC 12924 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6198
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90528 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO NOME COMERCIAL: YO-MIX 885 LYO 250 DCUDESCRICAO: Uma Mistura de cepas definidas de bacterias lacticas para inoculacao direta no leite e produtos a base de leite. A cult
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56019 - S.AUREUS NCTC 10788 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6131
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56019 - S.AUREUS NCTC 10788 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6161
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1102740001 COD. DO ITEM: 1102740001, NOME COMERCIAL: STERIKON BIOINDICADOR, NOME CIENTIFICO: SUSPENSAO DE ESPOROS GEOBACILLUS STEAROTHERMOPHILUS, CONCENTRACAO: 5.0E+05 - 1.0E+07 SPOROS POR UNIDADE, DENSIDADE: 1 G/CM3, COR: VIOLETA AVERMELHADA, ODOR:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56013 - C.ALBICANS NCPF 3179 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT 20 FRASCOS CONTENDO 1 BIOBALL CADA 6170
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56013 - C.ALBICANS NCPF 3179 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT 20 FRASCOS CONTENDO 1 BIOBALL CADA 6170
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50589 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: YO-MIX 495 LYO 250 DCU DESCRICAO: Misturas de cepas de bacterias laticas selecionadas para inoculacao direta em leite e outros alimentos.LOTE: 44938631
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CAIXA COM 100 UNIDADES DE GEOBACILO ESTEAROTERMOFILO, MINI SELF CONTADOR BIOLOGICO, PARA CONTROLE DE QUALIDADE INDUSTRIAL, CODIGO: SCS-100.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

COD: C601003 - CELULA COMPETENTE ONE SHOT DE CELULAS DE E. COLI BL21 STAR (DE3)(CX-20UN) - FABR: THERMO COD. C601003/ 440049 - CÉLULA QUIMICAMENTE COMPETENTE E. COLI. FUNÇÃO: CÉLULA CAPAZ DE RECEBER UM PLASMÍDEO E SE MULTIPLICAR EM MEIO DE CULTIVO. A
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANTICORPO MONOCLONAL ANTI-TETANO - (AMPOLA C/ 0,5ML) - 10/134 NR. DE LOTE: 10/134
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANTICORPO POLICLONAL ANTI-TETANO - (AMPOLA C/ 0,5 ML) - 10/132 NR. DE LOTE: 10/132
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANTISSORO ANTI INFLUENZA ANTI A/ANHUI/1/2013) - (H7) HA (FR. C/ 2ML) - 15/248 NR. DE LOTE: 15/248
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANTIGENO INFLUENZA A/ANHUI/1/2013 (FR.) - 16/238 NR. DE LOTE: 16/238
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANTISSORO INFLUENZA A/SINGAPORE/INFIMH-16-0019/2016 - (FR. C/ 2 ML) - 18/108 NR. DE LOTE: 18/108
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANTISSORO DE REFERECIA INFLUENZA B/COLORADO/06/2017 - NIBSC - 18/170 NR. DE LOTE: 18/170
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANTIGENO INFLUENZA B/VICTORIA B/VICTORIA/2/87 (FR.) - 87/774 NR. DE LOTE: 87/774
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANTIGENO INFLUENZA A/SWITZERLAND/8060/201 - (FR.) - 18/188 LOTE: 18/188
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANTISSORO INFLUENZA A/SWITZERLAND/8060/2017 - (FR. C/ 2 ML) - 18/192 LOTE NR: 18/192
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANTIGENO INFLUENZA A/SINGAPORE/INFIMH-16-0019/2016 - (FR.) - 17/246 NR. DE LOTE: 17/246
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DIAN-DIAH09-500UL - ANTICORPO IDH1 R132H (H09), MONOCLONAL IGG2A - 500UL - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : DIANOVA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

70200704602 Fatura: 9233046752 P.O./It 21092459/0001 INDICADOR BIOLOGICO PARA MONITORAR CICLO DE ESTERILIZACAO A OXIDO DE ETILENO, FEITO DE TIRA DE PAPEL CONTENDO ESPOROS DO BACILLUS SUBTILIS. CALDO NUTRIENTE CONTIDO EM UMA AMPOLA DE VIDRO QUEBRAVEL.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90680 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZIT STAR 22 LYO 125 DCU.DESCRICAO: Cultura lactea concentrada liofilizada para inoculacao direta em leite ou produtos a base de leite. Trata-se mi
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704927 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS SSC-100?X500U - cada caixa contem 10 Ev
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE NEGATIVO E POSITIVO PARA UTILIZACAO COM O ENSAIO ANTI-SARS-COV-2 (COVID-19). O CONTROLE PRECICONTROL ANTI SARS COV 2 E UM SORO DE CONTROLE PRONTO A UTILIZAR BASEADO EM SORO HUMANO. OS CONTROLES SAO UTILIZADOS PARA MONITORIZAR A EXATIDAO DO I
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM YO-443 250 U IDC, CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA . NUMERO DE LOTE: M2306V.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FRASCO COM 3ml. DE SALMONELLA O GRUPO A-I, PARA USO INDUSTRIAL, CODIGO: 222641.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

10/272: VACINA BCG CEPA MOREAU-RJ (1º MATERIAL DE REFERÊNCIA OMS), NIBSC NÚMERO DE REFERÊNCIA 10/272USO COMO MATERIAL DE REFERÊNCIA INTERNACIONAL COM A FINALIDADE DE MONITORAR PERIODICAMENTE A CONSISTÊNCIA DE ENSAIOS QUANTITATIVOS D
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CC-305, 5U Descricao do produto: Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. GT00048064 - prod. 17/02/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO CHEESE CC-303, 5U Descricao do produto: Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. GT00047912 - prod. 17/02/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

100242 - Cultura de microrganismos liofilizados (Lactococcus lactis subsp e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - FD-DVS RST-743 25X200U - Cada caixa contém 25
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50380 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO.: MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em env
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR DE ENSAIO B12 II CAL1: 2 FRASCOS, CADA UM PARA 1.0 ML DE CALIBRADOR 1 B12 II CAL2: 2 FRASCOS, CADA UM PARA 1.0 ML DE CALIBRADOR 2 VITAMIN B12 EM DOIS INTERVALOS DE CONCENTRACAO (APROXIMADAMENTE 185 PMOL/L OU 250 PG/ML E APROXIMADAMENTE 110
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50592 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO NOME COMERCIAL: YO-MIX 496 LYO 100 DCUDESCRICAO: UMA MISTURA DE CEPAS DEFINIDAS DE BACTERIAS LACTICAS PARA INOCULACAO DIRETA NO LEITE E PRODUTOS A BASE DE LEITE. A CULT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM B450 - FERMENTO LÁCTEO B450 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 25U IDC - LOTE: M2250F-R16 DATA DE FABRICAÇÃO: 08/02/2021 - DATA DE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704993 - Culturas de microrganismos liofilizados (Thermophilic lactic acid culture) empregados como fermentos lácteos na preparação de derivados de leite (iogurte, quefir, ácido lático) F-DVS YoFlex® YF-L01 DA cada caixa contem 10 envelopes.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

84113001-1VL - Codigo do item: 84113001-1VL , Nome comercial: Linha celular VERO, Forma de uso: controle de qualidade, Finalidade: comercial/industrial , Unidade Comercializada: embalagem com 1 frasco, Forma de apresentacao: solido Pedido: 4552039945
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR COMPOSTO POR MATRIZ DE SORO HUMANO LIOFILIZADA, UTILIZADO PARA CALIBRAR O ENSAIO QUANTITATIVO ELECSYS IGF 1 NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E FAMILIA IGF-1 IGF-1 CS ELECSYS P/N: 07475969190 APRESENTACAO: CALSET IGF-1 - 4 X
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

H0001769530 Fatura: 9233058909 P.O./It 21097374/0001 INDICADOR BIOLOGICO,CONTENDO CULTURA DEMICROOORGANISMOS (B.STEAROTHERMOPHILUS)EM TIRAS DE PAPEL DE FILTRO, ARMAZENADAS EM FRASCOS PLASTICOS, UTILIZADO PARA MONITORIZACAO A VAPOR. ITEM NAO REGULAMEN
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 214-14 - RECOMBINANTE DE INTERLEUCINA-4 (IL-4) MURINO - 100UG - LOTE: 031949 K0220
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 400-28 - RECOMBINANTE M-CSF PRODUZIDO EM RATO ? 50UG - LOTE: 1007418 H1720
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 400-30 - RECOMBINANTE DE LIGAÇÃO SRANK, PRODUZIDO EM RATO ? 50 UG - LOTE: 1208437 J0319
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

722865 - Cultura de microrganismo congelado (Lactobacillus delbrueckii subsp. bulgaricus Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS YoFlex® Premium 11 - caixa
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY354 - KIT ELISA DE BMP-7 DUOSET HUMANO, PARA 15 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A RÁBANO-PEROXIDASE (ESTRE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY220 - KIT ELISA PDGF-BB DUOSET HUMANO, PARA 15 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A RÁBANO-PEROXIDASE (ESTREP
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY6821 - KIT ELISA DE PROLACTINA DUOSET HUMANA, PARA 15 PLACAS, COMPOSTO POR: - CAPTURAR ANTICORPO - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A RÁBANO-PEROXIDASE (E
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY293B - KIT ELISA VEGF DUOSET HUMANO, PARA 15 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A RÁBANO-PEROXIDASE (ESTREPTA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY243 - KIT ELISA DE TGF-BETA 3 DUOSET HUMANO, 15 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A RÁBANO-PEROXIDASE (ESTRE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-LHT/F3-50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES LHT/F3 50 DOSI - M422 - 50U - LOTE: 0321545 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/20
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-LHT/F4-50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES LHT/F4 50 DOSI - M422 - 50U - LOTE: 0321546 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/20
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-LHT/F1-50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES LHT/F1 50 DOSI - M422 - 50U - LOTE: 0321543 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/20
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-LHT/F2-50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES LHT/F2 50 DOSI - M422 - 50U - LOTE: 0321544 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/20
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 210-10 - RECOMBINANTE MURINO DE INTERLEUCINA 10 (IL-10) - 50UG - LOTE: 051453 L3019
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 210-13 - RECOMBINANTE MURINO DE INTERLEUCINA 13 (IL-13) - 50UG - LOTE: 1111207 L2920
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: PRHYPE - HIPERFAGO M13 K07?PIII, FORNECE FUNÇÃO DE FAGO AUXILIAR NO EMPACOTAMENTO DE UM FAGOMÍDEO DE EXIBIÇÃO DE FAGO COMUM. INFECÇÃO DE BACTÉRIAS VIA PIII - 5X2ML, 2 ML POR FRASCO DE VIDRO - L
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY515 - KIT ELISA CXCL1 / CINC-1 DUOSET, PRODUZIDO EM RATO, 15 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A RÁBANO-PERO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY564 - KIT ELISA VEGF DUOSET, PRODUZIDO EM RATO, 15 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A RÁBANO-PEROXIDASE (ES
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY506 - KIT ELISA DE INTERLEUCINA-6 (IL-6) DUOSET, PRODUZIDO EM RATO, 15 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A R
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY525 - KIT ELISA CXCL2 / CINC-3 DUOSET, PRODUZIDO EM RATO, 15 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A RÁBANO-PERO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY522 - KIT ELISA DE INTERLEUCINA-10 (IL-10), PRODUZIDO EM RATO, 15 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A RÁBANO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY518 - KIT ELISA GM-CSF DUOSET, PRODUZIDO EM RATO, 15 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A RÁBANO-PEROXIDASE (
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY501 - KIT ELISA DE INTERLEUCINA-1 BETA (IL-1 BETA)/INTERLEUCINA-1F2 (IL-1F2) DUOSET, PRODUZIDO EM RATO, 15 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO- PADRÃO RECOMBI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY510 - KIT ELISA TNF-ALFA DUOSET, PRODUZIDO EM RATO, 15 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A RÁBANO-PEROXIDASE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES CONTROLADORES/CALIBRADORES DO TESTE ELECSYS ANTI-TSHR FAMILIA ELECSYS TSH TSH CALSET 4 X 1.3 ML P/N: 08443459190 APRESENTACAO: TSH CALSET - CAL1 2 X 1.3ML E CAL2 2 X 1.3ML CONDICAO DO PRODUTO: NOVO REGISTRO: 10287411445 VALIDADE: VIG
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704906 - Culturas de microrganismos congelados (Lactococcus lactis subsp. cremoris, Lactococcus lactis subsp. lactis, Lactococcus lactis subsp. lactis biovar. diacetylactis e Leuconostoc) empregadas como fermento lácteo na preparação de derivados de
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

IMUNOENSAIO PARA DETERMINACAO QUANTITATIVA IN VITRO DA TROPONINA T CARDIACA EM SORO E PLASMA HUMANOS FAMILIA ELECSYS TROPONIN T HS TROPONIN T HS ELECSYS COBAS E 200 V2 P/N: 08469717190 APRESENTACAO: ELECSYS TROPONIN T HS - 200 TESTES - M 12ML R1 14ML
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

72246 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: YO-MIXDESCRICAO: Trata-se de uma mistura de cepas definidas de bacterias lacticas para a inoculacao direta no leite e produtos a base de leite. A cult
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE NEGATIVO E POSITIVO PARA UTILIZACAO COM O ENSAIO ANTI-SARS-COV-2 (COVID-19). O CONTROLE PRECICONTROL ANTI SARS COV 2 E UM SORO DE CONTROLE PRONTO A UTILIZAR BASEADO EM SORO HUMANO. OS CONTROLES SAO UTILIZADOS PARA MONITORIZAR A EXATIDAO DO I
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

712117 - Cultura de microrganismos congelados (Lactococcus lactis subsp. cremoris, Lactococcus lactis subsp. lactis e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-E
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50402 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZIT BT 02 LYO 250 DCU.DESCRICAO: Cultura lactea concentrada liofilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DRP300 - KIT ELISA DE ADIPONECTINA/ACRP30 QUANTIKINE TOTAL HUMANA, COMPOSTO POR: - MICROPLACA ADIPONECTINA HUMANA - 01 PLACA - PADRÃO DE ADIPONECTINA HUMANA - 02 FRASCOS- ADIPONECTINA CONJUGADA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

61017610 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: CHOOZIT BC01 FRO 500 DCU DESCRICAO: Cultura concentrada congelada, na forma de pellets para inoculacao direta no leite. LOTE: 4113854976 - 15,000 kgs (30 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES CONTROLADORES/CALIBRADORES DO TESTE ELECSYS ANTI-TSHR FAMILIA ELECSYS ANTI-TSHR CAL-SET ANTI-TSHR 2 X 2 ML EACH LEVEL P/N: 08496641190 APRESENTACAO: CALSET ANTI-TSHR - CAL1 2 X 2.0ML E CAL2 2 X 2.0ML CONDICAO DO PRODUTO: NOVO REGISTR
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY4645-05 - KIT ELISA R-SPONDINA 1 DUOSET HUMANO, PARA 5 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A RÁBANO-PEROXIDASE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PLASMA HUMANO NORMAL CITRATADO EM POOL, PARA CALIBRACAO DE ENSAIOS DE COAGULACAO SELECCIONADOS NOS EQUIPAMENTOS ANALISADORES COBAS T INDICADOS CAL PLASMA CALIBRATOR PLASMA COBAS T411 (10X1ML) P/N: 07141904190 APRESENTACAO: 10 x 1ML CONDICAO DO PRODUT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS SALIVARIUS 50G/BAG - 50BAG CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/ANATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PRODUTO:. DELVO CHEESE CP 124,DSF,5U DESCRICAO DO PRODUTO: CULTURAS CONGELADAS ALTAMENTE CONCENTRADAS DE BACTERIAS PRODUTORAS DE ACIDO LATICO; FINALIDADE: UTILIZACAO NA FABRICACAO DE QUEIJOS E IOGURTES NA INDUSTRIA DE LATICINIOS;LOTE NR.: SY210953 -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PRODUTO:. DELVO CHEESE CP 123,DSF,5U DESCRICAO DO PRODUTO: CULTURAS CONGELADAS ALTAMENTE CONCENTRADAS DE BACTERIAS PRODUTORAS DE ACIDO LATICO; FINALIDADE: UTILIZACAO NA FABRICACAO DE QUEIJOS E IOGURTES NA INDUSTRIA DE LATICINIOS;LOTE NR.: SY210960 -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SORO DE CONTROLE LIOFILIZADO BASEADO EM SORO HUMANO EM DOIS INTERVALOS DE CONCENTRACAO, UTILIZADO PARA O CONTROLE DA QUALIDADE DOS IMUNOENSAIOS ESPECIFICADOS NOS ANALISADORES DE IMUNOENSAIOS ELECSYS E COBAS E.FAMILIA IGF-1PRECICONTROL GROWTH ELECSYS
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56055 - STAPHYLOCOCCUS AUREUS NCTC - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6308
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FRASCO COM 3ml. DE SALMONELLA H FLAGELAR A/Z, PARA USO INDUSTRIAL, CODIGO: 224061.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

412540 - BIOBALL SINGLESHOT MIXED KIT - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT 10 FRASCOS CONTENDO 1 BIOBALL CADA 200
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

412540 - BIOBALL SINGLESHOT MIXED KIT - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT 10 FRASCOS CONTENDO 1 BIOBALL CADA 200
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR PARA DETERMINACAO QUANTITATIVA DE TIROGLOBULINA, UTILIZANDO ANALISADORES DE IMUNOENSAIO ELECSYS TG FAMILIA ELECSYS TG IITG G2 CS ELECSYS V2P/N: 08991405190APRESENTACAO: TG II CALSET - CAL1 2 X 1,0ML E CAL2 2 X 1,0ML)CONDICAO DO PRODUTO: NO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50542 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em sache
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50409 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO.: NOME COMERCIAL: CHOOZIT MA 11 LYO 250 DCU DESCRICAO: Cultura lactica concentrada liofilizada para inoculacao direta em leite ou produtos a base de leiteLOTE: 44938458
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

685530 - Cultura de microrganismos liofilizados (Lactobacillus acidophilus, Bifidobacterium, Lactobacillus delbrueckii subsp. Bulgaricus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56050 - CANDIDA ALBICANS NCPF 3179 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 5763
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR PARA DETERMINACAO QUANTITATIVA DE IGFBP-3 EM SORO E PLASMA, UTILIZANDO OS SISTEMAS ROCHE/HITACHI COBAS C. FAMILIA IGFBP-3 IGFBP-3 CS ELECSYS P/N: 07574762190 APRESENTACAO: CALSET IGFBP-3 - 4 X 1.0 ML CONDICAO DO PRODUTO: NOVO REGISTRO: 102
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704931 - Cultura de microrganismo congelado (Streptococcus thermophilu, Lactobacillus delbrueckii subsp. bulgaricus, Lactococcus and bifidobacterium) empregada como fermento lácteo na preparação de iogurte- F-DVS - SSC101 - caixas contendo 10 envelop
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704707 - Cultura de microrganismos congelados (Lactococcus lactis subsp. cremoris Lactococcus lactis subsp. lactis, Lactococcus lactis subsp. lactis biovar. diacetylactis Leuconostoc) empregada como fermento lácteo na preparação de derivados de leite
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704842 - Cultura de microrganismos congelados (Streptococcus thermophilus, Lactobacillus acidophilus e Bifidobacterium) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS ABT-6 - cada cx contem
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MXA2021 - KIT CONTÉM: (4)0.50ML PLASMA, (2)4.00ML LINFÓCITOS ISOLADOS DE SANGUE PERIFÉRICO (PBL).PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO.ETIQUETAS: (1)MXC01P, (1)MXC02P, (1)MXC03P, (1)MXC04P, (1)MXC05C,
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FRASCO COM 3ml. DE SALMONELA H GRUPO I, PARA USO INDUSTRIAL, CODIGO: 228241.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: SANT-SC516142-0,5ML - PROTEÍNA M-IGG? BP-B CONJUGADA POR BIOTINA, IGG, PRODUZIDO EM CAMUNDONGO ? 0,5ML/FRASCO - LOTE: F0420
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES CONTROLADORES/CALIBRADORES DO TESTE ELECSYS ANTI-TSHR FAMILIA ELECSYS ANTI-TSHR CAL-SET ANTI-TSHR 2 X 2 ML EACH LEVEL P/N: 08496641190 APRESENTACAO: CALSET ANTI-TSHR - CAL1 2 X 2.0ML E CAL2 2 X 2.0ML CONDICAO DO PRODUTO: NOVO REGISTR
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

70200704602 Fatura: 9233046752 P.O./It 21095684/0001 INDICADOR BIOLOGICO PARA MONITORAR CICLO DE ESTERILIZACAO A OXIDO DE ETILENO, FEITO DE TIRA DE PAPEL CONTENDO ESPOROS DO BACILLUS SUBTILIS. CALDO NUTRIENTE CONTIDO EM UMA AMPOLA DE VIDRO QUEBRAVEL.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANTICORPO MONOCLONAL ANTI-DIFTERIA - (FR.) - 10/130 NR. DE LOTE: 10/130
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56014 - C.SPOROGENES NCTC 12935 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6105
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

IMUNOENSAIO PARA DETERMINACAO QUANTITATIVA IN VITRO DA TROPONINA T CARDIACA EM SORO E PLASMA HUMANOS.FAMILIA ELECSYS TROPONIN T HSTROPONIN T HS ELECSYS E2G 300 V2P/N: 08469873190APRESENTACAO: ELECSYS TROPONIN T HS - 300 TESTES - M 12,4ML ; R1 15,8ML
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

09H6902 CELL-DYN 18 PLUS CONTROL (LOW, NORMAL, HIGH) APRESENTACAO: MEIA EMB.: 6 TUBOS DE 2,5 ML CADA, SENDO CTR BAIXO 2 X 2,5 ML; CTR NORMAL 2 X 2,5 ML E CTR ALTO 2 X 2,5ML CELL-DYN 18 PLUS CONTROLE E UM PRODUTO PARA USO DIAGNOSTICO IN VITRO, QUE POD
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISAS CIENTIFICAS E TECNOLOGICAS NAO TERA USO MEDICO-ODONTO-HOSPITALAR HUMANO OU NA AGROPECUARIA:01 COD: T7471 REAGENTE FALOIDINA TEXAS-VERMELHO - SONDA DE F-ACTINA DE ALTA AFINIDADE CONJUGADA COM TEXAS VERMELHO-X BRI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1257385 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO. SENDO; NOME COMERCIAL: CHOOZIT EYES 2 LYO 2 D Descricao: Cultura liofilizada e concentrada para inoculacao direta em leite. LOTE: 4113848584 - 0,250 kgs (50 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

61017610 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZITDESCRICAO: Culturas concentrada congeladas em forma de peletes para inoculacao direta em leite, composta por Lactococcus lactis subsp. Lacti
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

A35243 - PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: REAGENTE CEL INSETO EXPISF9 1TUBO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PLASMA HUMANO NORMAL CITRATADO EM POOL, PARA CALIBRACAO DE ENSAIOS DE COAGULACAO SELECCIONADOS NOS EQUIPAMENTOS ANALISADORES COBAS T INDICADOS CAL PLASMA CALIBRATOR PLASMA COBAS T411 (10X1ML) P/N: 07141904190 APRESENTACAO: 10 x 1ML CONDICAO DO PRODUT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM BY220 - FERMENTO LACTEO BY220 UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 5U IDC - LOTE: M2250I DATA DE FABRICAÇÃO: 08/02/2021 - DATA DE VAL
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

GLIA2021 - KIT CONTÉM: (4)LAMINAS CONTENDO TECIDO DE PELE HUMANA,(1)H&E SLIDE,(4)40.00 UL GENOMIC DNA - PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO.ETIQUETAS: (1)GLI01, (1)GLI02, (1)GLI03, (1)GLI04, (1)GLI0
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P0710 FAMILIA ALINITY I HIV AG/AB COMBO APRESENTACAO.: ALINITY I HIV AG/AB COMBO CONTROLS - CONTROLE NEGATIVO: 1 X 8,0 ML/CONTROLE POSITIVO 1: 1 X 8,0 ML/CONTROLE POSITIVO 2: 1 X 8,0 ML/CONTROLE POSITIVO 3: 1 X 8,0 ML CONTROLE NEGATIVO: E PREPARADO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56011 - A.BRASILIENSIS (NIGER) 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6182
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CAIXA COM 100 TIRAS DE GEOBACILO ESTEAROTHERMOFILO ESPOROS 10/5, PARA CONTROLE DE QUALIDADE INDUSTRIAL, CODIGO: BS-105.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CMSPA2021 - KIT CONTENDO: (3)80.00uL DNA PURIFICADO, PARA FINS DE TESTE DE PROFICIÊNCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETAS: (1)CMSP01, (1)CMSP02, (1)CMSP03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES CONTROLADORES/CALIBRADORES DO TESTE ELECSYS ANTI-TSHR FAMILIA ELECSYS ANTI-TSHR CAL-SET ANTI-TSHR 2 X 2 ML EACH LEVEL P/N: 08496641190 APRESENTACAO: CALSET ANTI-TSHR - CAL1 2 X 2.0ML E CAL2 2 X 2.0ML CONDICAO DO PRODUTO: NOVO REGISTR
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-TX/A1-70 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES TX/A1 70 DOSI - M450-70U - LOTE: 0321551 - DATA DE FABRICAÇÃO: 16/03/2021- DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-TX/A2-70 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES TX/A2 70 DOSI - M450-70U - LOTE: 0321552 - DATA DE FABRICAÇÃO: 16/03/2021- DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-TX/A3-70 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES TX/A3 70 DOSI - M450-70U - LOTE: 0321553 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-TX/A4-70 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES TX/A4 70 DOSI - M450-70U - LOTE: 0321554 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56029 - C. SPOROGENES NCTC 12935 30X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6208
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56017 - P.AERUGINOSA NCTC 12924 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6198
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90525 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em sache
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56017 - P.AERUGINOSA NCTC 12924 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6198
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50378 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZIT RA 21 LYO 125 DCU.DESCRICAO: Cultura lactea concentrada liofilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SIGM-MAB4337-Anticorpos sendo anti uff fr/100ug Marca: Sigma Utilizado na pesquisa em neurociencias na tecnica de Western blotting, Lot#3542479
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ICSPA2021 - (3)80.00 UL DNA PURIFICADO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETA: (1)ICSP01, (1)ICSP02, (1)ICSP03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO).
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: Cod 700922 ATCC cepa de halobacterium sp designacao de cepa nrc1 jcm11081 formato do produto liofilizado armazenamento entre 2 e 8C BSL 1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56150 - BIOBALL MIXED KIT 10E8X10 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 10 FRASCOS CONTENDO 1 BIOBALL CADA 201
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56016 + E.COLI NCTC 12923 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6191
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P0622 FAMILIA ALINITY I ANTI-HCV APRESENTACAO: ALINITY I ANTI-HCV REAGENT KIT - MICROPARTICULAS: 2 X 6,6 ML/CONJUGADO: 2 X 6,1 ML/DILUENTE DE ENSAIO: 2 X 10,4 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO HCV (E.COLI, LEVEDURA, RECOMBI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50405 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em saches multifol
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50588 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: YO-MIX 495 LYO 100 DCU DESCRICAO: Misturas de cepas de bacterias laticas selecionadas para inoculacao direta em leite e outros alimentos.LOTE: 44938446
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 214-14 - RECOMBINANTE MURINO DE INTERLEUCINA 4 (IL-4) - 50UG - LOTE: 071949 L2920
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 501050-KIT - KIT ELISA DE VITAMINA D, 96 POÇOS SÓLIDOS, LOTE: 0606032 - VALIDADE: 28.02.2022 - COMPOSTO POR: - 401052 - VITAMINA D ELISA ANTICORPO MONOCLONAL - 1 FRASCO / 100 DTN- 401050 - VITA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1102740002 COD. DO ITEM: 1102740002, NOME COMERCIAL: STERIKON BIOINDICADOR, NOME CIENTIFICO: SUSPENSAO DE ESPOROS GEOBACILLUS STEAROTHERMOPHILUS, CONCENTRACAO: 5.0E+05 - 1.0E+07 SPOROS POR UNIDADE, DENSIDADE: 1 G/CM3, COR: VIOLETA AVERMELHADA, ODOR:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1102740002 COD. DO ITEM: 1102740002, NOME COMERCIAL: STERIKON BIOINDICADOR, NOME CIENTIFICO: SUSPENSAO DE ESPOROS GEOBACILLUS STEAROTHERMOPHILUS, CONCENTRACAO: 5.0E+05 - 1.0E+07 SPOROS POR UNIDADE, DENSIDADE: 1 G/CM3, COR: VIOLETA AVERMELHADA, ODOR:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

C22842 PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: SUBUNIT B DE TOXINA DE COLERA_ALEXA FLUOR 594 ( CHOLERA TOXIN SUBUNIT B )
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: INH-MCC-10MG - INIBIDOR DO INFLAMASSOMA NLRP3 - MCC950 - 10MG - LOTE: MC9-42-01(2) - FABRICANTE: INVIVOGEN USA - 3950 SORRENTO VALLEY BLVD, SUITE 100, SAN DIEGO, CA 92121 - USA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 1000000098 - CONJUNTO DE VETORES EASYCLONE-MARKERFREE, COMPOSTO POR: - A / 1 - PLASMÍDEO PCFB2899 (X-2 MARKERFREE) - AMPICILINA - A / 2 - PLASMÍDEOPCFB3034 (X-3 MARKERFREE) - AMPICILINA- A / 3
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 1000000118 - KIT DE FERRAMENTAS DE 27 PLASMÍDEOS CAS9-SGRNA (PCUT), COMPOSTO POR: - A / 1 - PLASMÍDEO P426_CAS9_GRNA-ARS106A - AMPICILINA - A / 2 - PLASMÍDEO P426_CAS9_GRNA-ARS208A - AMPICILINA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 1000000073 - KIT DE FERRAMENTAS DE LEVEDURA EASYCLONE 2.0, COMPOSTO POR: - A / 1 - PLASMÍDEO PCFB2188 - AMPICILINA - A / 2 - PLASMÍDEO PCFB2189 - AMPICILINA- A / 3 - PLASMÍDEO PCFB2226 - AMPICI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: Cod CRL 10317 Linhagem celular MCF 10A humana extraida de tecido de glandula mamaria Produto em formato congelado Armazenar em temperatura de menos 130C nitrogenio liquido fase vapor
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07/272: VACINA BCG CEPA TOKYO 172 (1º MATERIAL DE REFERÊNCIA OMS), NIBSC NÚMERO DE REFERÊNCIA 07/272USO COMO MATERIAL DE REFERÊNCIA INTERNACIONAL COM A FINALIDADE DE ESTABELECIMENTO/VALIDAÇÃO DA TÉCNICA DE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

713612 - Cultura de microrganismos liofilizados(Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS STI-13 cada caixa contem 30 ev.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FRASCO COM 1ml. DE ASPERGILLUS FUMIGATUS, PARA USO INDUSTRIAL, CODIGO: A70110.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50383 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO NOME COMERCIAL: CHOOZIT RA 24 LYO 50 DCU DESCRICAO: Cultura latica liofilizada para inoculacao direta em leite ou produtos a base de leite.LOTE: 4493848672 - 0,840 kgs
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

704802 - Cultura de microrganismos congelados (Lactobacillus helveticus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS EMFOUR? x 500U - cada caixa contém 10ev.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR UTILIZADO PARA DEFINIR PADROES QUANTITATIVOS ELECSYS PROGESTERONE III NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E PROGESTERONE III CALSET PROGESTERONE G3 CS ELECSYS P/N: 07092547190 APRESENTACAO: 4 x 1.0 ML (CAL 1: 2 x 1,0 ML/ Cal 2:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS CURVATUS 20G/BAG - 100BAG CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/ANATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA-
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90447 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: YO-MIXDESCRICAO: Trata-se de uma mistura de cepas definidas de bacterias lacticas para a inoculacao direta no leite e produtos a base de leite. A cult
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90527 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: YO-MIXDESCRICAO: Trata-se de uma mistura de cepas definidas de bacterias lacticas para a inoculacao direta no leite e produtos a base de leite. A cult
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PAINEL REFERENCIA P/ ANTICORPO - (ANTI-SARS-COV-2) - 20/268
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CÓDIGO BIO: 48214 VIRUS, CAXUMBA;HETEROLOGO;MUURABE002P3, GSK;PER;FR 10,5ML
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CÓDIGO BIO: 48213 VIRUS, SARAMPO;HETEROLOGO;MEEDM036P3, GSK;PER;FR 10,5ML
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90871 - CULTURA DE MICROORGANISMOS, FERMENTO, MARCA COMERCIAL: YO-MIX Yogurt Cultures DESCRICAO: Trata-se de um produto farmaceutico, caracterizando-se como culturas de microrganismos e,mais particularmente, como culturas Streptococcus thermophillus
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07/274: VACINA BCG CEPA RUSSA BCG-I (1º MATERIAL DE REFERÊNCIA OMS), NIBSC NÚMERO DE REFERÊNCIA 07/274USO COMO MATERIAL DE REFERÊNCIA INTERNACIONAL COM A FINALIDADE DE MONITORAR PERIODICAMENTE A CONSISTÊNCIA DE ENS
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MABT-36601-Anticorpos sendo anti human b-cell fr/100ug Marca: Mantech Utilizado na pesquisa em neurociencias na tecnica de Western blotting, Lot#3
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P5101 FAMILIA ALINITY I CA 15-3 APRESENTACAO.: ALINITY I CA 15-3 CALIBRATORS - 6 X 3,0 ML CAL A CONTEM TAMPAO TRIS COM ESTABILIZADOR DE PROTEINA (BOVINA). CAL B F CONTEM ANTIGENIO DEFINIDO POR DF3 (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZADOR
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90872 - CULTURA DE MICROORGANISMOS, FERMENTO, MARCA COMERCIAL: YO-MIX Yogurt Cultures DESCRICAO: Trata-se de um produto farmaceutico, caracterizando-se como culturas de microrganismos e,mais particularmente, como culturas Streptococcus thermophillus
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50538 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: CHOOZIT TM 81 LYO 50 DCU DESCRICAO: Cultura lactica concentrada liofilizada para inoculacao direta em leite ou produtos a base de leite.LOTE: 449382240
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

HBF07 - Nome: HEM DIRECT (Individual).DISPOSITIVO TESTE DE PLASTICO MEDINDO 6,5 X 3,5 CM, COM ESPACO PARA AMOSTRA E AREA PARA LEITURA DE RESULTADO, ENVOLVENDO TIRA DE PAPEL ABSORVENTEIMPREGNADA DE REAGENTE PARA A DETECCAO DE HEMOGLOBINA HUMANA NAS AM
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

412647 - BIOBALL MIXED SA (550X12) - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 10 FRASCOS CONTENDO 1 BIOBALL CADA 216
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

WAKO-01919741-50UG - ANTICORPOO IBA1 (PARA IMUNOCITOQUIMICA) - FR/50UG - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : FUJIFILM WAKO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P9310 FAMILIA ALINITY I FREE PSA APRESENTACAO: ALINITY I FREE PSA CONTROLS - CONTROLS LOW: 8ML; CONTROLS MEDIUM: 8ML; CONTROLS HIGH: 8ML OS CONTROLES CONTEM PSA (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZANTE DE PROTEINA (BOVINA). CONSERVANTES:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY6456-05-1KIT - KIT ELISA DE EBI3 DUOSET, HUMANO, LOTE: P262305 - VALIDADE: 24.02.2025 - COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY8226-05-1KIT - KIT ELISA DE HETERODÍMERO S100A8 / S100A9 DUOSET, HUMANO, LOTE: P260612 - VALIDADE: 24.02.2025 - COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO- PADRÃO RECOMBINAN
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY911-05-1KIT - KIT ELISA DE MMP-9 DUOSET HUMANO, LOTE: P239459 - VALIDADE: 17.09.2024 - COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJU
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLES UTILIZADOS PARA FAZER VERIFICACOES DO SISTEMA E TESTES DE CONTROLE DE QUALIDADE DO TEMPO DE TROMBOPLASTINA PARCIAL ACTIVADA (APTT) COM O APARELHO COAGUCHEK PRO II E FAMILIA COAGUCHEK APTT COAGUCHEK APTT CONTROLS (LEVEL 1 + 2) P/N: 068826921
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE UTILIZADO PARA FAZER VERIFICACOES DE CONTROLE DE QUALIDADE DE ENSAIOS DE COAGULACAO ESPECIFICADOS NOS EQUIPAMENTOS ANALISADORES DE COAGULACAO COBAS T FAMILIA DE CONTROLES T411 CONTROL 4 COBAS T411 (20X1ML) P/N: 07106912190 APRESENTACAO: CONT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

150-05A - Codigo do item: 150-05A, Nome Comercial: Celulas do musculo esqueletico humano: HSkMC, adulto, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com500,00 celulas, Forma de a
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 5036-WN-010/CF - PROTEÍNA RECOMBINANTE DE WNT-3A HUMANA (SEM TRANSPORTE) - 10UG
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-TX/A3-50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES TX/A3 50 DOSI - M450 - 50U - LOTE: 0321561 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/2023
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-TX/A2-50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES TX/A2 50 DOSI - M450 - 50U - LOTE: 0321560 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/2023
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-TX/A1-50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES TX/A1 50 DOSI - M450 - 50U - LOTE: 0321559 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/2023
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-TX/A4-50 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES TX/A4 50 DOSI - M450 - 50U - LOTE: 0321562 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/2023
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

A15587 - PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: REAGENTE NEURONIO PRIMARIOS DEHIPOCAMPO DE CAM 1000000 1UN -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

340 FROM 10.03.2021 - Cultura bacterial ( Streptococcus salivarius ssp. thermophilus Lactobacillus delbrueckii ssp. bulgaricus) concentrada linha perfil YO 22.11 R5 - P/N YO2211R550AU, (50 AU) - LOTE:340 Nome Comercial: Golden Line ProfilineEspecific
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 4645-RS-025/CF - PROTEÍNA RECOMBINANTE DE R-SPONDINA 1 HUMANA (SEM TRANSPORTE) - 25UG
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

422190 - SALMONELLA TYPHIMURIUM 6195
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 575306 - RECOMBINANTE IFN-?, PRODUZIDO EM CAMUNDONGO (SEM TRANSPORTE) ? 100UG
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CELL-4377S-Anticorpos sendo anti rabbit mab fr/200ul Marca: Cell Signaling Utilizado na pesquisa em neurociencias na tecnica de Western blotting, Lot#12
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90681 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada para inoculacao direta em leite ou produtos a base de leite. Trata-se mistura concentrada de
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR COM DOIS NIVEIS DE CONCENTRACAO DE AMH NUMA MATRIZ DE SORO EQUINO LIOFILIZADO FAMILIA ELECSYS AMH PLUS AMH PLUS CS ELECSYS P/N: 07957203190 MODELO: CALSET AMH PLUS - 4 X 1.0 ML CONDICAO DO PRODUTO: NOVO REGISTRO: 10287411268 VALIDADE: VIGE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR COM DOIS NIVEIS DE CONCENTRACAO DE AMH NUMA MATRIZ DE SORO EQUINO LIOFILIZADO FAMILIA ELECSYS AMH PLUS AMH PLUS CS ELECSYS P/N: 07957203190 MODELO: CALSET AMH PLUS - 4 X 1.0 ML CONDICAO DO PRODUTO: NOVO REGISTRO: 10287411268 VALIDADE: VIGE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR COM DOIS NIVEIS DE CONCENTRACAO DE AMH NUMA MATRIZ DE SORO EQUINO LIOFILIZADO FAMILIA ELECSYS AMH PLUS AMH PLUS CS ELECSYS P/N: 07957203190 MODELO: CALSET AMH PLUS - 4 X 1.0 ML CONDICAO DO PRODUTO: NOVO REGISTRO: 10287411268 VALIDADE: VIGE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR COM DOIS NIVEIS DE CONCENTRACAO DE AMH NUMA MATRIZ DE SORO EQUINO LIOFILIZADO FAMILIA ELECSYS AMH PLUS AMH PLUS CS ELECSYS P/N: 07957203190 MODELO: CALSET AMH PLUS - 4 X 1.0 ML CONDICAO DO PRODUTO: NOVO REGISTRO: 10287411268 VALIDADE: VIGE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

TUBOS PARA MATERIAL DE COLETA, DE USO DO LABORATÓRIO (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (YAU-0222 - 5 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (YAU-0431 - 5 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (YAU-0221 - 5 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (YAU-0432 - 5 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

91133 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: DANISCO VEGE CulturesDESCRICAO: Trata-se de uma mistura de cepas definidas de bacterias do acido latico, composta de Streptococcus thermophilus e Lact
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CULTURA DE MICROORGANISMOS UTILIZADA COMO MATERIA PRIMA PARA FABRICAÇÃO DO PRODUTO BIOLÓGICO ENZILIMP, REGISTRO ANVISA: 323850008. NOME COMERCIAL: BIO REMOVE HC, MARCA COMERCIAL: NOVOZYMES BIOLOGICAL INC. LOTE NUMERO: 020D820. SENDO: BIOREMOVE HC (11
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

RNAA2021 - KIT CONTÉM: (3)25.00 UL RNA. PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETAS: (1)RNA01, (1)RNA02, (1)RNA03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

RNAA2021 - KIT CONTÉM: (3)25.00 UL RNA. PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETAS: (1)RNA01, (1)RNA02, (1)RNA03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ZXM2449604 - NOME COMERCIAL: DELVO CHEESE CP-504 10U - CLASSE: CULTURAS LACTEAS (STREPTOCOCCUS THERMOPHILUS) - FORMA FISICA: GRANULOS - PROCESSO DE OBTENÇAO: FERMENTACAO, CONCENTRACAO E CONGELAMENTO - CAS: NAO APLICAVEL - DCB: NAO APLICAVEL- FINALIDA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ZXM2449503 - NOME COMERCIAL: DELVO CHEESE CP-503 10U - CLASSE: CULTURAS LACTEAS (STREPTOCOCCUS THERMOPHILUS) - FORMA FISICA: GRANULOS - PROCESSO DE OBTENÇAO: FERMENTACAO, CONCENTRACAO E CONGELAMENTO - CAS: NAO APLICAVEL - DCB: NAO APLICAVEL- FINALIDA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ZXM2449410 - NOME COMERCIAL: DELVO CHEESE CP-502 10U - CLASSE: CULTURAS LACTEAS (STREPTOCOCCUS THERMOPHILUS) - FORMA FISICA: GRANULOS - PROCESSO DE OBTENÇAO: FERMENTACAO, CONCENTRACAO E CONGELAMENTO - CAS: NAO APLICAVEL - DCB: NAO APLICAVEL- FINALIDA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR COMPOSTO POR MATRIZ DE SORO HUMANO LIOFILIZADA, UTILIZADO PARA CALIBRAR O ENSAIO QUANTITATIVO ELECSYS IGF 1 NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E FAMILIA IGF-1 IGF-1 CS ELECSYS P/N: 07475969190 APRESENTACAO: CALSET IGF-1 - 4 X
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56044 - S.TYPHIMURIUM NCTC 12023 30X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6256
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P5110 FAMILIA ALINITY I CA 15-3 APRESENTACAO: ALINITY I CA 15-3 CONTROLS - 2 X 8,0 ML OS CONTROLES CONTEM ANTIGENO DEFINIDO POR DF3 (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZADOR DE PROTEINA (BOVINA). CONSERVANTES: AZIDA DE SODIO E PROCLIN 30
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC100560-Anticorpos sendo anti mfn2 fr/100ug Marca: Santa Cruz Utilizado na pesquisa em neurociencias na tecnica de Western blotting, Lot#B0121
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

713005 - Culturas de microrganismos congelados (Bifidobacterium infantis, Bifidobacterium lactis, Lactobacillus acidophilus, Lactobacillus fermentum, Lactobacillus lactis, Lactobacillus paracasei, Lactobacillus rhamnosus, Lactococcus lactis subsp. cr
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC390974AF488 - ANTICORPO CYP27A1 (G-2), MONOCLONAL IGG2A K, CONJUGADO AF 488 200UG/ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC53850AF488 - ANTICORPO CYP3A4 (HL3), MONOCLONAL IGG1, CONJUGADO AF 488 200UG/ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC53876PERCP - ANTICORPO FOXP3 (2A11G9), IGG2A, CONJ. PERCP - 100 TESTES/2 ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SORO DE CONTROLE LIOFILIZADO BASEADO NUMA MATRIZ DE SORO EQUINO COM AMH BOVINO ADICIONADO (SORO BOVINO FETAL MASCULINO) EM DOIS INTERVALOS DE CONCENTRACAO.FAMILIA ELECSYS AMH PLUSAMH PLUS PC ELECSYSP/N: 07957211190MODELO: PRECICONTROL AMH PLUS - 4 X
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC136960-Anticorpos sendo anti a3 fr/200ug Marca: Santa Cruz Utilizado na pesquisa em neurociencias na tecnica de Western blotting, Lot#J2220
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC365062-Anticorpos sendo anti gapdh fr/200ug Marca: Santa Cruz Utilizado na pesquisa em neurociencias na tecnica de Western blotting, Lot#K1220
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC376938-Anticorpos sendo anti hprt fr/200ug Marca: Santa Cruz Utilizado na pesquisa em neurociencias na tecnica de Western blotting, Lot#E0520
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC20047PE-1ML - ANTICORPO CD3 (PC3/188A) IGG1, CONJUGADO PE, 200UG/ML - 1ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SORO DE CONTROLE LIOFILIZADO BASEADO NUMA MATRIZ DE SORO EQUINO COM AMH BOVINO ADICIONADO (SORO BOVINO FETAL MASCULINO) EM DOIS INTERVALOS DE CONCENTRACAO. FAMILIA ELECSYS AMH PLUS AMH PLUS PC ELECSYS P/N: 07957211190 MODELO: PRECICONTROL AMH PLUS -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC518007AF488 - ANTICORPO CYP27A1 (E-10), MONOCLONAL IGG1A K, CONJ. AF 488 200UG/ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES CONTROLADORES/CALIBRADORES DO TESTE ELECSYS ANTI-TSHR FAMILIA ELECSYS TSHTSH CALSET 4 X 1.3 ML P/N: 08443459190APRESENTACAO: TSH CALSET - CAL1 2 X 1.3ML E CAL2 2 X 1.3MLCONDICAO DO PRODUTO: NOVOREGISTRO: 10287411445VALIDADE: VIGENTEL
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

54951 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em sache
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P0722 FAMILIA ALINITY I HIV AG/AB COMBO APRESENTACAO: ALINITY I HIV AG/AB COMBO REAGENT KIT - MICROPARTICULAS: 2 X 6,6 ML/CONJUGADO: 2 X 6,1 ML/DILUENTE DE ENSAIO: 2 X 6,3 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO HIV-1/HIV-2 (RECO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56022 - A.NIGER NCPF 2275 30X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6263
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

85020206-1VL - Codigo do item: 85020206-1VL, Nome Comercial: Vero C1008 ÝVero 76, clone E6, Vero E6¨, Forma de uso: pesquisa e desenvolvimento(R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com1 frasco , Forma de apresentac
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CELL-4695S-Anticorpos sendo anti rabbit mab fr/200ul Marca: Cell Signaling Utilizado na pesquisa em neurociencias na tecnica de Western blotting, Lot#28
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: SANT-36688-10UM - SILENCIADORES DE GENES, SIRNA E PLASMÍDEOS SHRNA DE TNF-R1, PRODUZIDO EM CAMUNDONGO - 10UM/FRASCO - LOTE: L1012
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: SANT-SC37217-10UM - SILENCIADORES DE GENES, SIRNA E PLASMÍDEOS SHRNA DE TNFA, PRODUZIDO EM CAMUNDONGO - 10UM/FRASCO - LOTE: C0216
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: SANT-36690-10UM - SILENCIADORES DE GENES, SIRNA E PLASMÍDEOS SHRNA DE TNF-R2, PRODUZIDO EM CAMUNDONGO - 10UM/FRASCO - LOTE: G0511
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50579 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: NOME COMERCIAL: YO-MIX 300 LYO 100 DCU DESCRICAO: Misturas de cepas de bacterias laticas selecionadas para inoculacao direta em leite e outros alimentos.LOTE: 44938580
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FRASCO COM 3ml. DE SALMONELA H GRUPO I, PARA USO INDUSTRIAL, CODIGO: 228241.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P1010 FAMILIA ALINITY I HBSAG QUALITATIVE II APRESENTACAO.: ALINITY I HBSAG QUALITATIVE II CONTROLS - CONTROLE NEGATIVO: 1 X 8,0 ML/CONTROLE POSITIVO: 1 X 8,0 ML CONTROLE NEGATIVO CONTEM PLASMA HUMANO RECALCIFICADO. CONSERVANTES: PROCLIN 950 E AZID
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

C854003 PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: OMNIMAX2_ CELULAS QUIMICAMENTE COMPETENTES (OMNIMAX2 CHEMICALLY COMP CELLS) -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC377227-1ML - ANTICORPO CX3CR1 (B-7), MONOCLONAL, IGG2A, 200UG/ML -FR/1ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC99-1ML - ANTICORPO P53, MONOCLONAL, IGG, 200 UG/ML - FR/1ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC135809-0.5ML - ANTICORPO HMG-1 (J2E1), MONOCLONAL, IGG2B, 50UG/ML -FR/0.5ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC6260-1ML - ANTICORPO VIMENTIN (V9), MONOCLONAL, IGG1, 200UG/ML - FR/1ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC59623-1ML - ANTICORPO O-GLCNAC (CTD110.6), MONOCLONAL IGM - 200UG/ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56014 - C.SPOROGENES NCTC 12935 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6105
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56014 - C.SPOROGENES NCTC 12935 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6105
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56014 - C.SPOROGENES NCTC 12935 550X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6105
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO BY220 UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 5U IDC (LACTOFERM BY220 DRY STARTERS) - LOTE: M2308G - DATA DE FABRICAÇÃO: 06/04/202
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (JOY LOB-02 2 - 10 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (JOY LOB-02 1 - 10 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56030 - E. AEROGENES NCTC 10006 30X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 5895
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM B830 - FERMENTO LÁCTEO B830 UTILIZADO PARA A FABRICAÇÃO DE QUEIJOS E IOGURTES, COMPOSTO POR: LACTOCOCCUS LACTIS SUBSP. LACTIS E LACTOCOCCUS LACTIS SBSP. CREMORIS - POUCHES 5U IDC - LOTE: M2250H DATA DE FABRICAÇÃO: 08/02/2021 - DATA DE VALID
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FRASCO COM 3ml. DE SALMONELLA GRUPO SPICER-EDWARDS 1, PARA USO INDUSTRIAL, CODIGO: 222651.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50543 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em sache
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PLASMA HUMANO NORMAL CITRATADO EM POOL, PARA CALIBRACAO DE ENSAIOS DE COAGULACAO SELECCIONADOS NOS EQUIPAMENTOS ANALISADORES COBAS T INDICADOS CAL PLASMA CALIBRATOR PLASMA COBAS T411 (10X1ML) P/N: 07141904190 APRESENTACAO: 10 x 1ML CONDICAO DO PRODUT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

T3194-25UG - Codigo do item: T3194-25UG, Nome Comercial: Toxina do tetano deClostridium tetani, Composicao Quimica: x, Forma de uso: pesquisaa e desenvolvimento(R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com25 microgram
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50539 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em sache
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

54949 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO NOME COMERCIAL: CHOOZIT RA 71 LYO 125 DCU.DESCRICAO: Cultura lactea concentrada liofilizada para inoculacao direta em leite ou produtos a base de leite. Acondicionado e
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

S9399-.5MG - Codigo do item: S9399-.5MG, Nome Comercial: Enterotoxina estafilococica A deStaphylococcus aureus, Nr CAS: 642595-84-4, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem c
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: Cod 47054-ATCC cepa de Pseudomonas putida designacao da cepa KT2440 1ml Formato do produto congelado Armazenamento a menos 80 C BSL 1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PLASMA HUMANO NORMAL CITRATADO EM POOL, PARA CALIBRACAO DE ENSAIOS DE COAGULACAO SELECCIONADOS NOS EQUIPAMENTOS ANALISADORES COBAS T INDICADOS CAL PLASMA CALIBRATOR PLASMA COBAS T411 (10X1ML) P/N: 07141904190 APRESENTACAO: 10 x 1ML CONDICAO DO PRODUT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

BMVA2021 - KIT CONTENDO: (3)1.00ML SORO, (6)5.00ML SORO. PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO ETIQUETAS: (1)BMV301, (1)BMV302,(1)BMV303,(1)BMV401,(1)BMV402,(1)BMV304,(1)BMV501,(1)BMV502, (1)BMV503.NÃ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

89050205-1VL - Codigo do item: 89050205-1VL, Nome Comercial: Linha celular SAOS-2 humana, Forma de uso: pesquisa e desenvolvimento(R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com1 frasco, Forma de apresentacao: solido ,
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

IMUNOENSAIO PARA DETERMINACAO QUANTITATIVA IN VITRO DA TROPONINA T CARDIACA EM SORO E PLASMA HUMANOS FAMILIA ELECSYS TROPONIN T HS TROPONIN T HS ELECSYS COBAS E 200 V2 P/N: 08469717190 APRESENTACAO: ELECSYS TROPONIN T HS - 200 TESTES - M 12ML R1 14ML
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

27204 - NITRIBIOTIC 50 ML/1.7 FL.OZ. 1 MASTERCARTON = 6 PC. - BACTERIAS NITRIFICANTES PARA AQUARIOS - COMPOSICAO: AGUA E COMBINACAO DE BACTERIAS AEROBICAS PARA FILTRAGEM DA AGUA DO AQUARIO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

85112105-1VL - Codigo do item: 85112105-1VL, Nome Comercial: CCRF-CEM Leucemia linfoblastica aguda humana caucasiana, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com1 frasco, For
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 3174-MP-250 - PROTEÍNA RECOMBINANTE MIELOPEROXIDASE HUMANA, (SEM TRANSPORTADOR) ? 250UG - FABRICANTE: R&D SYSTEMS, INC. - 614 MCKINLEY PLACE NE, MINNEAPOLIS, MN 55413 - USA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR PARA ENSAIO ELECSYS CORTISOL II CORT II CAL1: 2 FRASCOS, CADA UM PARA 1.0 ML DE CALIBRADOR 1 CORT II CAL2: 2 FRASCOS, CADA UM PARA 1.0 ML DE CALIBRADOR 2 CORTISOL (SINTETICO) EM DOIS INTERVALOS DE CONCENTRACAO (APROX. 12.5 NMOL/L OU 0.45 G
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MGL1A2021 - KIT CONTÉM: (6)50.00 UG DNA EXTRAÍDO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETA:(1)MGL01, (1)MGL02, (1)MGL03, (1)MGL04, (1)MGL05, (1)MGL06.NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SEC1A2021 - KIT CONTENDO: (2)PELLET LIOFILIZADO, (3)30.00 UG DNA EXTRAÍD, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)SEC101, (1),SEC102, (1)SEC103, (1)SET1F, (1)SET1R.NÃO INFECCIOSO, NÃO PER
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6410 FAMILIA ALINITY I HBEAG APRESENTACAO.: ALINITY I HBEAG CONTROLS - CONTROLE NEGATIVO: 1 X 8,0 ML/CONTROLE POSITIVO: 1 X 8,0 ML CONTROLE NEGATIVO: CONTEM PLASMA HUMANO RECALCIFICADO. CONSERVANTES: AGENTES ANTIMICROBIANOS. CONTROLE POSITIVO: CON
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

RETTA2021 - KIT CONTÉM: (3)10.00 UG DNA EXTRAÍDO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETA: (1)RETTA01,(1)RETTA02,(1)RETTA03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

00-4976-93 PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: LIPOPOLYSACCHARIDE SOLN 500X
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MTPA2021 - KIT CONTENDO: (3)40.00 uL DE DNA GENOMICO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO ETIQUETAS: (1)MTP01, (1)MTP02, (1)MTP03 NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

APOEA2021 - KIT CONTÉM: (3)10.00 UG DNA EXTRAÍDO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETAS: (1)APOE01,(1)APOE02,(1)APOE03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO).
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

70200763566 Fatura: 9233051566 P.O./It 21097336/0001 INDICADOR BIOLOGICO COMPOSTO POR AMPOLA CONTENDO ESPOROS DOGEOBACILLUS STEAROTHERMOPHILUS COM UMA POPULACAO MINIMA DE 1X105 ESPOROS POR TIRA PARA SER UTILIZADO EM MONITORAMENTO DECICLOS DE ESTERILI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

713507 - Cultura de microrganismos liofilizados (Streptococcus thermophilus e Lactobacillus delbrueckii subsp. bulgaricus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático)FD-DVS CH-1- cada caixa conte
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 315-05 - RECOMBINANTE MURINO DE IFN-? ? 100UG - LOTE: 061798-1 K3020
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY8056-05 - KIT ELISA DE INSULINA HUMANA / CANINA / SUÍNA DUOSET, PARA 5 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A R
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: DY4645-05 - KIT ELISA R-SPONDINA 1 DUOSET HUMANO, PARA 5 PLACAS, COMPOSTO POR: - ANTICORPO DE CAPTURA - ANTICORPO DE DETECÇÃO - PADRÃO RECOMBINANTE- ESTREPTAVIDINA CONJUGADA A RÁBANO-PEROXIDASE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: 300-02 - RECOMBINANTE IFN-GAMMA HUMANA - 100UG - LOTE: 091927 A2721
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P9210 FAMILIA ALINITY I TOTAL PSA APRESENTACAO: ALINITY I TOTAL PSA CONTROLS - CONTROL L: 8 ML; CONTROL M: 8 ML; CONTROL H: 8 ML CONTROLES CONTEM PSA (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZADOR DE PROTEINA (BOVINA). ALINITY I TOTAL PSA CONT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P9210 FAMILIA ALINITY I TOTAL PSA APRESENTACAO: ALINITY I TOTAL PSA CONTROLS - CONTROL L: 8 ML; CONTROL M: 8 ML; CONTROL H: 8 ML CONTROLES CONTEM PSA (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZADOR DE PROTEINA (BOVINA). ALINITY I TOTAL PSA CONT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P9210 FAMILIA ALINITY I TOTAL PSA APRESENTACAO: ALINITY I TOTAL PSA CONTROLS - CONTROL L: 8 ML; CONTROL M: 8 ML; CONTROL H: 8 ML CONTROLES CONTEM PSA (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZADOR DE PROTEINA (BOVINA). ALINITY I TOTAL PSA CONT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P9210 FAMILIA ALINITY I TOTAL PSA APRESENTACAO: ALINITY I TOTAL PSA CONTROLS - CONTROL L: 8 ML; CONTROL M: 8 ML; CONTROL H: 8 ML CONTROLES CONTEM PSA (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZADOR DE PROTEINA (BOVINA). ALINITY I TOTAL PSA CONT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P1001 FAMILIA ALINITY I HBSAG QUALITATIVE II APRESENTACAO.: ALINITY I HBSAG QUALITATIVE II CALIBRATORS - CAL 1: 1 X 3,0 ML/CAL 2: 1 X 3,0 ML CAL 1 CONTEM HBSAG HUMANO PURIFICADO INATIVADO (SUBTIPO AD) EM TAMPAO FOSFATO COM OS ESTABILIZANTES PLASMA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6022 FAMILIA ALINITY I SYPHILIS TP APRESENTACAO: ALINITY I SYPHILIS TP REAGENT KIT - MICROPARTICULAS:2 X 4,2 ML/CONJUGADO: 2 X 4,2 ML/DILUENTE DE ENSAIO: 2 X 5,9 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO TP (E.COLI, RECOMBINANTE)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50417 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO.: MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em env
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

85011430-1VL - Codigo do item: 85011430-1VL, Nome Comercial: Linha Celular Hep G2 humana, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com1 frasco , Forma de apresentacao: solido
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR UTILIZADO PARA DEFINIR PADROES QUANTITATIVOS ELECSYS PROGESTERONE III NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS EPROGESTERONE III CALSETPROGESTERONE G3 CS ELECSYSP/N: 07092547190APRESENTACAO: 4 x 1.0 ML (CAL 1: 2 x 1,0 ML/ Cal 2: 2x1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50406 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em saches multifol
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

BOST-M00438-100UG - ANTICORPO ANTI-LAMIN A/C, MONOCLONAL - 100UG - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : BOSTER BIOLOGICAL TECHNOLOGY
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANTICORPO HUMANO - (ANTI-SARS-COV-2) - 20/136
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

92102117-1VL - Codigo do item: 92102117-1VL, Nome Comercial: Mioblasto de musculo esqueletico de rato L6.G8, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com1 frasco , Forma de ap
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

412647 - BIOBALL MIXED SA (550X12) - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 10 FRASCOS CONTENDO 1 BIOBALL CADA 197
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

412647 - BIOBALL MIXED SA (550X12) - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 10 FRASCOS CONTENDO 1 BIOBALL CADA 216
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

11635018 PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: ELECTROMAX_ CELULAS COMPETENTES STBL4 (ELECTROMAX STBL4 COMP CELLS) -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

84113001-1VL - Codigo do item: 84113001-1VL , Nome comercial: Linha celular VERO, Forma de uso: controle de qualidade, Finalidade: comercial/industrial , Unidade Comercializada: embalagem com 1 frasco, Forma de apresentacao: solido Pedido: 4552039945
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

50411 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO.: MARCA COMERCIAL: CHOOZITDESCRICAO: Cultura lactea concentrada liofilizada, utilizada para inoculacao direta em leite ou produtos a base de leite, acondicionada em env
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P8722 FAMILIA ALINITY I ANTI-HBC II APRESENTACAO.: ALINITY I ANTI-HBC II REAGENT KIT - MICROPARTICULAS: 2 X 4,2 ML/CONJUGADO: 2 X 8,7 ML/ DILUENTE DE ENSAIO: 2 XDE 5,9 ML/DILUENTE DE AMOSTRA: 2 X 4,2 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS D
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN2A2021 - KIT CONTENDO:(14)5.00ML SORO,(6)3.00ML SORO, (7)2.00ML SORO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO.ETIQUETAS:(1)LN01SP, (1)LN02SP, (1)LN03SP, (1)LN04SP, (1)LN05SP, (1)LN06SP, (1)LN07SP, (1)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN2A2021 - KIT CONTENDO:(14)5.00ML SORO,(6)3.00ML SORO, (7)2.00ML SORO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO.ETIQUETAS:(1)LN01SP, (1)LN02SP, (1)LN03SP, (1)LN04SP, (1)LN05SP, (1)LN06SP, (1)LN07SP, (1)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: SANT-SC516140-0,5ML - PROTEÍNA M-IGG? BP-B CONJUGADA POR FITC, IGG, PRODUZIDO EM CAMUNDONGO ? 200UG/ML ? 0,5ML/FRASCO - LOTE: K1820
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: HY-114153-5MG - PLX5622 - PENETRANTE CEREBRAL ALTAMENTE SELETIVO E INIBIDOR DE CSF1R ATIVO ORAL COM UM KI DE 5,9 NM - 5MG - LOTE: 66533 - FABRICANTE: MEDCHEMEXPRESS LLC - DEER PARK DRIVE, 11 -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

88092904-1VL - Codigo do item: 88092904-1VL, Nome Comercial: Linha celular H9C2 (2-1) de rato, Forma de uso: pesquisa e desenvolvimento(R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com1 frasco, Forma de apresentacao: soli
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

87070202-1VL - Codigo do item: 87070202-1VL, Nome Comercial: HOS Osteossarcoma humano caucasiano, TE85, Forma de uso: pesquisa e desenvolvimento(R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com1 frasco, Forma de apresenta
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

BOST-A01372-100UG - ANTICORPO ANTI-VAPB PICOBAND, IGG, POLICLONAL - FR/100UG - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : BOSTER BIOLOGICAL TECHNOLOGY
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

91112502-1VL - Codigo do item: 91112502-1VL, Nome Comercial: 143B Osteossarcoma osseo humano TK, Forma de uso: pesquisa e desenvolvimento(R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com1 frasco, Forma de apresentacao: so
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P1010 FAMILIA ALINITY I HBSAG QUALITATIVE II APRESENTACAO.: ALINITY I HBSAG QUALITATIVE II CONTROLS - CONTROLE NEGATIVO: 1 X 8,0 ML/CONTROLE POSITIVO: 1 X 8,0 ML CONTROLE NEGATIVO CONTEM PLASMA HUMANO RECALCIFICADO. CONSERVANTES: PROCLIN 950 E AZID
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

86082104-1VL - Codigo do item: 86082104-1VL, Nome Comercial: Hs 578T Carcinoma de mama humano, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com1 frasco, Forma de apresentacao: sol
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P4910 FAMILIA ALINITY I CA 125 II APRESENTACAO: ALINITY I CA 125 II CONTROLS - 3 X 8,0ML CONTROLES CONTEM ANTIGENIO DEFINIDO DE OC 125 (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZADORES DE PROTEINA (BOVINA). CONSERVANTES: AZIDA DE SODIO E PROCLI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN22A2021 - KIT CONTÉM: (7)1.0ML SANGUE TOTAL. PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)LN2201, (1)LN2202, (1)LN2203, (1)LN2204, (1)LN2205, (1)LN2206, (1)LN2207.NÃO INFECCIOSO, NÃO PERIGOS
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN22A2021 - KIT CONTÉM: (7)1.0ML SANGUE TOTAL. PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)LN2201, (1)LN2202, (1)LN2203, (1)LN2204, (1)LN2205, (1)LN2206, (1)LN2207.NÃO INFECCIOSO, NÃO PERIGOS
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

Cod.: PSM400F - Nome: PSA SEMIQUANT (Individual).DISPOSITIVO TESTE DE PLASTICO MEDINDO 6,5 X 3,5 CM, COM ESPACO PARA AMOSTRA E AREA PARA LEITURA DE RESULTADO, ENVOLVENDO TIRA DE PAPELABSORVENTE IMPREGNADA DE REAGENTE PARA DETECCAO SEMI-QUANTITATIVA D
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: MIL13-10UG - RECOMBINANTE DE INTERLEUCINA-13 (IL-13), PRODUZIDO EM CAMUNDONGO - 10UG - LOTE: 311PMIL1309
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56023 - B. CEREUS NCTC 7464 30X20 20 FRASCOS CONTENDO 1 BIOBALL CADA - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. 6241
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE UTILIZADO PARA FAZER VERIFICACOES DE CONTROLE DE QUALIDADE DE ENSAIOS DE COAGULACAO ESPECIFICADOS NOS EQUIPAMENTOS ANALISADORES DE COAGULACAO COBAS T CONTROL N N COBAS T411 (20X1ML) P/N: 07128029190 APRESENTACAO: 20 x1ML CONDICAO DO PRODUTO:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

BRCAA2021 - KIT CONTENDO: (3)10.00ug DE DNA EXTRAÍDO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO ETIQUETAS: (1)BRCA01, (1)BRCA02, (1)BRCA03 NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

714890 - Cultura de microrganismos liofilizados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite(iogurte,quefir,ácido lático) FD-DVS STI-15 - cada cx contem 30 envelopes.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56029 - C. SPOROGENES NCTC 12935 30X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6369
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P1010 FAMILIA ALINITY I HBSAG QUALITATIVE II APRESENTACAO.: ALINITY I HBSAG QUALITATIVE II CONTROLS - CONTROLE NEGATIVO: 1 X 8,0 ML/CONTROLE POSITIVO: 1 X 8,0 ML CONTROLE NEGATIVO CONTEM PLASMA HUMANO RECALCIFICADO. CONSERVANTES: PROCLIN 950 E AZID
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56144 - PSEUDOMONAS AERUGINOSA NCTC - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 5836
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FRASCO COM 3ml. DE SALMONELLA POLIVALENTE GRUPO C1 FATORES 6, 7, PARA USO INDUSTRIAL, CODIGO: 229491.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56144 - PSEUDOMONAS AERUGINOSA NCTC - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 5836
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

H0001769530 Fatura: 9233048215 P.O./It 21096252/0001 INDICADOR BIOLOGICO,CONTENDO CULTURA DEMICROOORGANISMOS (B.STEAROTHERMOPHILUS)EM TIRAS DE PAPEL DE FILTRO, ARMAZENADAS EM FRASCOS PLASTICOS, UTILIZADO PARA MONITORIZACAO A VAPOR. ITEM NAO REGULAMEN
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

85120602-1VL - Codigo do item: 85120602-1VL, Nome comercial: 293 linha celular humano, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com 1 vL, Forma de apresentacao: liquido, Tipo
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-MAT1 -20 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES MAT1 20 DOSI - M310 - 20U LOTE: 0321535 - DATA DE FABRICAÇÃO: 16/03/2021- DATA DE VALIDADE: 15/03/2023
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-MAT3 -20 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES MAT3 20 DOSI - M310 - 20U LOTE: 0321537 - DATA DE FABRICAÇÃO: 16/03/2021- DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-MAT2 -20 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES MAT2 20 DOSI - M310 - 20U LOTE: 0321536 - DATA DE FABRICAÇÃO: 16/03/2021- DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-MAT4 -20 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES MAT4 20 DOSI - M310 - 20U LOTE: 0321538 - DATA DE FABRICAÇÃO: 16/03/2021- DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN9A2021 - KIT CONTENDO: (7)3.00ML GLÓBULOS BRANCOS DO SANGUE, (6)3.00ML GLÓBULOS VERMELHOS DO SANGUE, (7)3.00ML PLAQUETAS, PARA TESTE DE PROFICIÊNCIA.ETIQUETAS: (1)LN901P, (1)LN901R, (1)LN901W, (1)LN902P, (1)LN902R, (1)LN902W, (1)LN903P, (1)LN903R,
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN9A2021 - KIT CONTENDO: (7)3.00ML GLÓBULOS BRANCOS DO SANGUE, (6)3.00ML GLÓBULOS VERMELHOS DO SANGUE, (7)3.00ML PLAQUETAS, PARA TESTE DE PROFICIÊNCIA.ETIQUETAS: (1)LN901P, (1)LN901R, (1)LN901W, (1)LN902P, (1)LN902R, (1)LN902W, (1)LN903P, (1)LN903R,
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN9A2021 - KIT CONTENDO: (7)3.00ML GLÓBULOS BRANCOS DO SANGUE, (6)3.00ML GLÓBULOS VERMELHOS DO SANGUE, (7)3.00ML PLAQUETAS, PARA TESTE DE PROFICIÊNCIA.ETIQUETAS: (1)LN901P, (1)LN901R, (1)LN901W, (1)LN902P, (1)LN902R, (1)LN902W, (1)LN903P, (1)LN903R,
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN9A2021 - KIT CONTENDO: (7)3.00ML GLÓBULOS BRANCOS DO SANGUE, (6)3.00ML GLÓBULOS VERMELHOS DO SANGUE, (7)3.00ML PLAQUETAS, PARA TESTE DE PROFICIÊNCIA.ETIQUETAS: (1)LN901P, (1)LN901R, (1)LN901W, (1)LN902P, (1)LN902R, (1)LN902W, (1)LN903P, (1)LN903R,
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

NGSA2021 - KIT CONTENDO: (1)10.00ug DE DNA EXTRAÍDO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO ETIQUETAS: (1)NGS01, (1)NGS98 NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SORO DE CONTROLE LIOFILIZADO BASEADO NUMA MATRIZ DE SORO EQUINO COM AMH BOVINO ADICIONADO (SORO BOVINO FETAL MASCULINO) EM DOIS INTERVALOS DE CONCENTRACAO. FAMILIA ELECSYS AMH PLUS AMH PLUS PC ELECSYS P/N: 07957211190 MODELO: PRECICONTROL AMH PLUS -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CAIXA COM 100 TIRAS DE BACILLUS ATROFEUS ESPOROS 10/5, PARA CONTROLE DE QUALIDADE INDUSTRIAL, CODIGO: BG-105.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SORO DE CONTROLE LIOFILIZADO BASEADO NUMA MATRIZ DE SORO EQUINO COM AMH BOVINO ADICIONADO (SORO BOVINO FETAL MASCULINO) EM DOIS INTERVALOS DE CONCENTRACAO. FAMILIA ELECSYS AMH PLUS AMH PLUS PC ELECSYS P/N: 07957211190 MODELO: PRECICONTROL AMH PLUS -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

JACK-111065003-2ML - ANTICORPO SECUNDARIO, POLICLONAL, IGG (H+L), CONJUGADO BIOTINA-SP - 2ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : JACKSON IMMUNO RESEARCH
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

IDMEA2021 - KIT CONTENDO: (3)1,00ML DE SIMULADO DE FLUIDO CORPORAL, PARA TESTE DE PROFICIÊNCIA. ETIQUETAS: (1)IDME01, (2)IDME02, (3)IDME03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

90641 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO, SENDO: MARCA COMERCIAL: LH 100 LYO 10 DCU.DESCRICAO: Cultura lactea concentrada liofilizada para inoculacao direta em leite ou produtos a base de leite composto de Lactobacil
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08H5701 CELL-DYN HEMCAL PLUS CALIBRATOR/CELL-DYM HEMCAL PLUS CALIBRADOR APRESENTACAO: 2 FRASCOS DE 3,0 ML CELL-DYN HEMCAL PLUS CALIBRATOR / CELL-DYN HEM CAL PLUS CALIBRADOR PODE CONTER QUALQUER OU TODOS OS SEGUINTES COMPONENTES: ERITROCITOS HUMANOS O
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES CONTROLADORES/CALIBRADORES DO TESTE ELECSYS ANTI-TSHR FAMILIA ELECSYS TSH TSH CALSET 4 X 1.3 ML P/N: 08443459190 APRESENTACAO: TSH CALSET - CAL1 2 X 1.3ML E CAL2 2 X 1.3ML CONDICAO DO PRODUTO: NOVO REGISTRO: 10287411445 VALIDADE: VIG
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES CONTROLADORES/CALIBRADORES DO TESTE ELECSYS ANTI-TSHR FAMILIA ELECSYS TSHTSH CALSET 4 X 1.3 ML P/N: 08443459190APRESENTACAO: TSH CALSET - CAL1 2 X 1.3ML E CAL2 2 X 1.3MLCONDICAO DO PRODUTO: NOVOREGISTRO: 10287411445VALIDADE: VIGENTEL
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR DO ENSAIO QUANTITATIVO ELECSYS TROPONIN T HS NO ANALISADOR DE IMUNOENSAIO COBAS E 801 FAMILIA TROPONIN T HS TROPONIN T HS CS ELECSYS E2G P/N: 07401671190 APRESENTACAO: CALSET TROPONIN T HS - 4X1,0ML: TNTHS CAL1 2X1,0ML / TNTHS CAL2 2X1,0ML
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR UTILIZADO PARA DEFINIR PADROES QUANTITATIVOS ELECSYS PROGESTERONE III NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E PROGESTERONE III CALSET PROGESTERONE G3 CS ELECSYS P/N: 07092547190 APRESENTACAO: 4 x 1.0 ML (CAL 1: 2 x 1,0 ML/ Cal 2:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR DO ENSAIO QUANTITATIVO ELECSYS CK-MB NO ANALISADOR DE IMUNOENSAIO COBAS E 801 FAMILIA CK-MB CK-MB CS ELECSYS V4 E2G P/N: 07394667190 APRESENTACAO: CALSET CK-MB - 4 X 1.0 ML CONDICAO DO PRODUTO: NOVO REGISTRO: 10287411215 VALIDADE: 24/04/20
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (COMBY T2M1 - 5 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FERMENTO LACTEO LIOFILIZADO - UTILIZADO NA PRODUCAO DE QUEIJOS (COMBY T2M2 - 5 DU) - MARCA: IGEA.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56033 - E. COLI NCTC 9001 30X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6232
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLES UTILIZADOS PARA FAZER VERIFICACOES DO SISTEMA E TESTES DE CONTROLE DE QUALIDADE DO TEMPO DE PROTROMBINA COM O APARELHO COAGUCHEK PRO II E AS TIRAS-TESTE COAGUCHEK PT TEST STRIPS. FAMILIA COAGUCHEK PT COAGUCHEK PT CONTROLS (LEVEL 1+2) P/N: 0
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P0701 FAMILIA ALINITY I HIV AG/AB COMBO APRESENTACAO.: ALINITY I HIV AG/AB COMBO CALIBRATOR - 1 X 3,0 ML CONTEM LISADO VIRAL DE HIV PURIFICADO PREPARADO EM SOLUCAO SALINA TAMPONADA TRIS COM ESTABILIZANTE DE PROTEINA (BOVINA). CONSERVANTE: AZIDA SOD
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

TPMA2021 - KIT CONTÉM: (3)250.00 UL SIMULADO DE SANGUE TOTAL. PARA FINS DE TESTE DE PROFICIÊNCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETAS: (1)TPM01, (1)TPM02, (1)TPM03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO(USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56033 - E. COLI NCTC 9001 30X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6232
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P1001 FAMILIA ALINITY I HBSAG QUALITATIVE II APRESENTACAO.: ALINITY I HBSAG QUALITATIVE II CALIBRATORS - CAL 1: 1 X 3,0 ML/CAL 2: 1 X 3,0 ML CAL 1 CONTEM HBSAG HUMANO PURIFICADO INATIVADO (SUBTIPO AD) EM TAMPAO FOSFATO COM OS ESTABILIZANTES PLASMA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56033 - E. COLI NCTC 9001 30X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE. KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 6232
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

56032 - E. FAECALIS NCTC 775 30X20 - MATERIAL MICROBIOLÓGICO DE REFERÊNCIA QUE CONTÉM UM NÚMERO EXATO DE MICRO-ORGANISMOS VIÁVEIS PARA SER UTILIZADO COMO CONTROLE QUANTITATIVO DE QUALIDADE.KIT COM 20 FRASCOS CONTENDO 1 BIOBALL CADA 5972
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FRASCOS LIVRES DE METAIS PESADOS, DE USO DO LABORATÓRIO (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

11003032 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: PROBAT 322 FRO 500 DCU DESCRICAO: Cultura concentrada congelada, na forma de pellets para inoculacao direta no leite. LOTE: 4113866320 - 2,500 kgs (5 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

buf/hb Tampao Diluente para HEM DIRECT (Individual). 01 TUBO COM 1,5 ML DE TAMPAO DE EXTRACAO FINALIDADE / APLICACAOPRODUTO AUXILIAR PARA DILUICOES NO TESTE DE HEM DIRECT SERATEC. DESCRICAO / ESPECIFICACOESFRASCO PLASTICO DESCARTAVEL COM VOLUME DE 1,
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ZXM2549727 - NOME COMERCIAL: CESKA®-STAR D029.7 GABLETOP 200 UNITS - NOME PORTGUÊS: FERMENTO LÁCTEO- DESCRIÇÃO: CULTURA DE BACTÉRIA DE USO INDUSTRIAL, CONGELADA, PRÓPRIA PARA INOCULAÇÃO DE LEITE, DENOMINADO FERMENTO LÁCTEO, COMERCIALMENTE DENOMINADO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOBACILLUS CRISPATUS CARACTERISTICA:PO CLASSE:PRODUTO FARMACEUTICO USO:MEDICAMENTOSO CONFORME PRESCRICAO MEDICA FINALIDADE:DISTRIBUICAO(SEGMENTO:FARMACIAS DE MANIPULACAO) CAS:N/A NATUREZA DA MERCADORIA/ESTAGIO DE FABRICACAO:MATERIA-PRIMATEMPERATUR
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LACTOFERM PP-4 250 U IDC, CULTURA DE MICRORGANISMOS, CEPAS SELECIONADAS DEFINIDAS E CONCENTRADAS DE ORIGEM NATURAL, FORMA DE APRESENTACAO EM MICROGRANULOS DE COR BEGE CLARO, PARA USO NA INDUSTRIA LACTEA. NUMERO DE LOTE: M2306P.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PLASMA HUMANO NORMAL CITRATADO EM POOL, PARA CALIBRACAO DE ENSAIOS DE COAGULACAO SELECCIONADOS NOS EQUIPAMENTOS ANALISADORES COBAS T INDICADOS CAL PLASMA CALIBRATOR PLASMA COBAS T411 (10X1ML) P/N: 07141904190 APRESENTACAO: 10 x 1ML CONDICAO DO PRODUT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR UTILIZADO PARA CALIBRAR O ENSAIO QUANTITATIVO ELECSYS PTH PARA A PTH INTACTA (HORMONA PARATIROIDE) NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E. FAMILIA PTH PTH G2 STAT CS ELECSYS P/N: 08243930190 APRESENTACAO: CALSET PTH STAT - CAL1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR PARA ENSAIO ELECSYS CORTISOL II CORT II CAL1: 2 FRASCOS, CADA UM PARA 1.0 ML DE CALIBRADOR 1 CORT II CAL2: 2 FRASCOS, CADA UM PARA 1.0 ML DE CALIBRADOR 2 CORTISOL (SINTETICO) EM DOIS INTERVALOS DE CONCENTRACAO (APROX. 12.5 NMOL/L OU 0.45 G
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR PARA ENSAIO ELECSYS CORTISOL II CORT II CAL1: 2 FRASCOS, CADA UM PARA 1.0 ML DE CALIBRADOR 1 CORT II CAL2: 2 FRASCOS, CADA UM PARA 1.0 ML DE CALIBRADOR 2 CORTISOL (SINTETICO) EM DOIS INTERVALOS DE CONCENTRACAO (APROX. 12.5 NMOL/L OU 0.45 G
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P4910 FAMILIA ALINITY I CA 125 II APRESENTACAO: ALINITY I CA 125 II CONTROLS - 3 X 8,0ML CONTROLES CONTEM ANTIGENIO DEFINIDO DE OC 125 (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZADORES DE PROTEINA (BOVINA). CONSERVANTES: AZIDA DE SODIO E PROCLI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

BCMCPL - PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: REAGENTE MICROSSOMOS CAMUNDONGO BALBC 500UL -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

Ecocool - Inoculante para Silagem. Inoculante aplicável na forma liquida para silagem Para a conservação de forragens com alto risco de deterioração aeróbica. Contém L. plantarum (cepa MTD / 1) para auxiliar a fermentação e L. buchneri (cepa PJB / 1)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

Ecosyl - Inoculante para Silagem. Inoculante aplicável na forma liquida para silagem. Contém L. plantarum (cepa MTD / 1) para auxiliar na fermentação. origem do produto: reino Unido, procedencia: Reino Unido, produto em processo de registro sob nº 21
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE UTILIZADO PARA FAZER VERIFICACOES DE CONTROLE DE QUALIDADE DE ENSAIOS DE COAGULACAO ESPECIFICADOS NOS EQUIPAMENTOS ANALISADORES DE COAGULACAO COBAS T CONTROL N N COBAS T411 (20X1ML) P/N: 07128029190 APRESENTACAO: 20 x1ML CONDICAO DO PRODUTO:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLES UTILIZADOS PARA FAZER VERIFICACOES DO SISTEMA E TESTES DE CONTROLE DE QUALIDADE DO TEMPO DE TROMBOPLASTINA PARCIAL ACTIVADA (APTT) COM O APARELHO COAGUCHEK PRO II E FAMILIA COAGUCHEK APTT COAGUCHEK APTT CONTROLS (LEVEL 1 + 2) P/N: 068826921
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES CONTROLADORES/CALIBRADORES DO TESTE ELECSYS ANTI-TSHRFAMILIA ELECSYS ANTI-TSHRCAL-SET ANTI-TSHR 2 X 2 ML EACH LEVELP/N: 08496641190APRESENTACAO: CALSET ANTI-TSHR - CAL1 2 X 2.0ML E CAL2 2 X 2.0MLCONDICAO DO PRODUTO: NOVOREGISTRO: 102
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE UTILIZADO PARA FAZER VERIFICACOES DE CONTROLE DE QUALIDADE DE ENSAIOS DE COAGULACAO ESPECIFICADOS NOS EQUIPAMENTOS ANALISADORES DE COAGULACAO COBAS T CONTROL N N COBAS T411 (20X1ML) P/N: 07128029190 APRESENTACAO: 20 x1ML CONDICAO DO PRODUTO:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P3201 FAMILIA ALINITY I CA 19-9XR APRESENTACAO: ALINITY I CA19-9XR CALIBRATORS - CAL A: 1 X 3,0 ML; CAL B: 1 X 3,0 ML; CAL C: 1 X 3,0 ML; CAL D: 1 X 3,0 ML; CAL E: 1 X 3,0 ML; CAL F: 1 X 3,0 ML. CALIBRADOR A: CONTEM TAMPAO TRIS EM ESTABILIZANTE DE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE UTILIZADO PARA FAZER VERIFICACOES DE CONTROLE DE QUALIDADE DE ENSAIOS DE COAGULACAO ESPECIFICADOS NOS EQUIPAMENTOS ANALISADORES DE COAGULACAO COBAS T CONTROL N N COBAS T411 (20X1ML) P/N: 07128029190 APRESENTACAO: 20 x1ML CONDICAO DO PRODUTO:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CUSA-CSBPA000553-100 - ANTICORPO FOSFO-IRS1 (S1101), POLICLONAL IGG - 100UG - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : CUSABIO BIOTECH
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CUSA-CSBPA001656-100 - ANTICORPO CLDN1, POLICLONAL IGG - 100UG - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : CUSABIO BIOTECH
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CUSA-CSBPA003068-100 - ANTICORPO IRS1, POLICLONAL IGG - 100UG - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : CUSABIO BIOTECH
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

S4881-1MG - Codigo do item: S4881-1MG, Nome Comercial: Enterotoxina BestafilococicadeStaphylococcus aureus, Sinonimos: Enterotoxina B, Staphylococcal,SEB, Nr CAS: 11100-45-1, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/indus
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6401 FAMILIA ALINITY I HBEAG APRESENTACAO.: ALINITY I HBEAG CALIBRATORS - CALIBRADOR 1: 1 X 3,0 ML/CALIBRADOR 2: 1 X 3,0 ML CALIBRADOR 1: CONTEM TAMPAO TRIS COM ESTABILIZANTE DE PROTEINA (BOVINA). CONSERVANTES: AGENTES ANTIMICROBIANOS. CALIBRADOR
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DAYTEC BIO LIQUIDO 1000 (MEGA-BAC X - CONCENTRATED) - EMBALAGEM COM 03 (TRES) BOMBONAS DE POLIETILENO DE ALTA DENSIDADE (PEAD), COM CAPACIDADE DE 20 LITROS POR UNIDADE. TIPO DE FORMULACAO: LIQUIDO DE COLORACAO ROSA A MARROM, ODOR CARACTERIS_CO DE CUL
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

27202 - NITRIBIOTIC 25 ML/0.85 FL.OZ. 1 MASTERCARTON = 6 PC. - BACTERIAS NITRIFICANTES PARA AQUARIOS - COMPOSICAO: AGUA E COMBINACAO DE BACTERIAS AEROBICAS PARA FILTRAGEM DA AGUA DO AQUARIO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FRASCO COM 3ml. DE E. COLI H7, PARA USO INDUSTRIAL, CODIGO: 221591.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

GHER2A2021 - LAMINA 10-CORE MICROARRAY, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: GHER201 NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

18297010 PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: MAX EFF DH10B CELULAS COMPETENTES ( MAX EFF DH10B COMP CELLS ) -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CLOU-PAP553HU01-200U - ANTICORPO MMTV PARA WNT10B, POLICLONAL IGG - 200UL - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : CLOUD-CLONE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6122 FAMILIA ALINITY I RHTLV-I/II APRESENTACAO.: ALINITY I RHTLV-I/II REAGENT KIT - MICROPARTICULAS: 2 X 6,6 ML/CONJUGADO: 2 X 6,1 ML/DILUENTE DE ENSAIO: 2 X 8,0 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE PEPTIDEO SINTETICO DO HTLV-I/HTLV-I
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PM6A2021 - (1)LÂMINA COM TECIDO HUMANO PARA ANALISE TIPO MICROARRAY, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETA: (1)PM601. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

DSHB-TI4-1ML - ANTICORPO TI-4 / TNNI3, MONOCLONAL, SUPERNATANTE - FR/1ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : DSHB
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

F-A2021 - KIT CONTENDO: (5) PACOTE COM 2 COTONETES, (1)1.00ML LÍQUIDO LCR , (10)0.50 SOLUÇÃO SALINA DE BUFFER DE FOSFATO. ETIQUETAS: F-01, F-01DIL, F-02, F-02DIL,F-03, F-03DIL, F-04, F-04DIL, F-05, F-05DIL, F-06.NÃO INFECCIOSO, NÃO PERIGOSO, NÃO REST
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

K1681 - PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: CELULAS LANTHASCREENI KB ALPHAGRIPTITE -
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-LHT/F3-5 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES LHT/F3 5 DOSI - M422 - 5U - LOTE: 0321557 - DATA DE FABRICAÇÃO: 16/03/2021- DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-LHT/F4-5 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES LHT/F4 5 DOSI - M422 - 5U - LOTE: 0321558 - DATA DE FABRICAÇÃO: 16/03/2021 - DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-LHT/F1-5 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES LHT/F1 5 DOSI - M422 - 5U - LOTE: 0321555 - DATA DE FABRICAÇÃO: 16/03/2021- DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1024_FD-LHT/F2-5 FERMENTO DIRETTO - OUTRAS CULTURAS DE MICRORGANIMOS, SENDO: FERMENTO LACTEO, UTILIZADO PARA A FABRICACAO DE QUEIJOS E IOGURTES LHT/F2 5 DOSI - M422 - 5U - LOTE: 0321556 - DATA DE FABRICAÇÃO: 16/03/2021- DATA DE VALIDADE: 15/03/2023.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SOLUCAO UTILIZADA PARA CALIBRAR O ENSAIO QUANTITATIVO ELECSYS SIROLIMUS NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS EFAMILIA SIROLIMUS SIROLIMUS CS ELECSYSP/N: 06327982190APRESENTACAO SIROLIMUS CALSET - CA1 3 X 1.0ML CAL2 3 X 1.0MLCONDICAO DO PRO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SOLUCAO UTILIZADA PARA CALIBRAR O ENSAIO QUANTITATIVO ELECSYS SIROLIMUS NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS EFAMILIA SIROLIMUS SIROLIMUS CS ELECSYSP/N: 06327982190APRESENTACAO SIROLIMUS CALSET - CA1 3 X 1.0ML CAL2 3 X 1.0MLCONDICAO DO PRO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ABVDA2021 - KIT CONTÉM: (3)1.00ML SORO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)ABVD01, (1)ABVD02, (1)ABVD03.NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. PRODUTO. O PRODUTO É ENVIADO EM GE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

12034013 PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: MAX EFF DH5 ALFA T1 CELULAS COMPETENTES ( MAX EFF DH5 T1 COMP CELLS )
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P0701 FAMILIA ALINITY I HIV AG/AB COMBO APRESENTACAO.: ALINITY I HIV AG/AB COMBO CALIBRATOR - 1 X 3,0 ML CONTEM LISADO VIRAL DE HIV PURIFICADO PREPARADO EM SOLUCAO SALINA TAMPONADA TRIS COM ESTABILIZANTE DE PROTEINA (BOVINA). CONSERVANTE: AZIDA SOD
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

11393032 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: PROBAT 222 FRO 500 DCU DESCRICAO: Cultura concentrada congelada, na forma de pellets para inoculacao direta no leite. LOTE: 4113827435 - 2,500 kgs (5 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR DE ENSAIO B12 II CAL1: 2 FRASCOS, CADA UM PARA 1.0 ML DE CALIBRADOR 1 B12 II CAL2: 2 FRASCOS, CADA UM PARA 1.0 ML DE CALIBRADOR 2 VITAMIN B12 EM DOIS INTERVALOS DE CONCENTRACAO (APROXIMADAMENTE 185 PMOL/L OU 250 PG/ML E APROXIMADAMENTE 110
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR DE ENSAIO B12 II CAL1: 2 FRASCOS, CADA UM PARA 1.0 ML DE CALIBRADOR 1 B12 II CAL2: 2 FRASCOS, CADA UM PARA 1.0 ML DE CALIBRADOR 2 VITAMIN B12 EM DOIS INTERVALOS DE CONCENTRACAO (APROXIMADAMENTE 185 PMOL/L OU 250 PG/ML E APROXIMADAMENTE 110
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR COM DOIS NIVEIS DE CONCENTRACAO DE AMH NUMA MATRIZ DE SORO EQUINO LIOFILIZADOFAMILIA ELECSYS AMH PLUSAMH PLUS CS ELECSYSP/N: 07957203190MODELO: CALSET AMH PLUS - 4 X 1.0 MLCONDICAO DO PRODUTO: NOVOREGISTRO: 10287411268 VALIDADE: VIGENTE ÝL
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR UTILIZADO PARA CALIBRAR O ENSAIO QUANTITATIVO ELECSYS PTH PARA A PTH INTACTA (HORMONA PARATIROIDE) NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E.FAMILIA PTHPTH G2 STAT CS ELECSYSP/N: 08243930190APRESENTACAO: CALSET PTH STAT - CAL1 2X1,
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR UTILIZADO PARA CALIBRAR O ENSAIO QUANTITATIVO ELECSYS PTH PARA A PTH INTACTA (HORMONA PARATIROIDE) NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E. FAMILIA PTH PTH G2 STAT CS ELECSYS P/N: 08243930190 APRESENTACAO: CALSET PTH STAT - CAL1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

61032003 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: CHOOZIT MH11 FRO 500 DCU DESCRICAO: Cultura concentrada congelada, na forma de pellets para inoculacao direta no leite. LOTE: 4113841504 - 2,500 kgs (5 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNV - Codigo do item: SHCLNV, Nome Comercial: MISSION Clones individuaisshRNA, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com 1 unidade, Forma de apresentacao: solido , Tempe
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNV - Codigo do item: SHCLNV, Nome Comercial: MISSION Clones individuaisshRNA, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com 1 unidade, Forma de apresentacao: solido , Tempe
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNV - Codigo do item: SHCLNV, Nome Comercial: MISSION Clones individuaisshRNA, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com 1 unidade, Forma de apresentacao: solido , Tempe
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNV - Codigo do item: SHCLNV, Nome Comercial: MISSION Clones individuaisshRNA, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com 1 unidade, Forma de apresentacao: solido , Tempe
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNV - Codigo do item: SHCLNV, Nome Comercial: MISSION Clones individuaisshRNA, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com 1 unidade, Forma de apresentacao: solido , Tempe
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNV - Codigo do item: SHCLNV, Nome Comercial: MISSION Clones individuaisshRNA, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com 1 unidade, Forma de apresentacao: solido , Tempe
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNV - Codigo do item: SHCLNV, Nome Comercial: MISSION Clones individuaisshRNA, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com 1 unidade, Forma de apresentacao: solido , Tempe
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNV - Codigo do item: SHCLNV, Nome Comercial: MISSION Clones individuaisshRNA, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com 1 unidade, Forma de apresentacao: solido , Tempe
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNV - Codigo do item: SHCLNV, Nome Comercial: MISSION Clones individuaisshRNA, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com 1 unidade, Forma de apresentacao: solido , Tempe
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNV - Codigo do item: SHCLNV, Nome Comercial: MISSION Clones individuaisshRNA, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Comercializada: embalagem com 1 unidade, Forma de apresentacao: solido , Tempe
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P5101 FAMILIA ALINITY I CA 15-3 APRESENTACAO.: ALINITY I CA 15-3 CALIBRATORS - 6 X 3,0 ML CAL A CONTEM TAMPAO TRIS COM ESTABILIZADOR DE PROTEINA (BOVINA). CAL B F CONTEM ANTIGENIO DEFINIDO POR DF3 (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZADOR
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ABCA-AB120952-10MG-Anticorpos sendo anti stat3 fr/10mg Marca: Abcam Utilizado na pesquisa em neurociencias na tecnica de Western blotting, Lot#APN19078-1-1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

JACK-005000121-10ML - ANTICORPO DE SORO NORMAL - FR/10ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : JACKSON IMMUNO RESEARCH
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE DE QUALIDADE DO IMUNOENSAIO ELECSYS HBSAG IMUNOENSAIO ELECSYS E COBAS E PC HBSAGQN1: 5 FRASCOS, CADA CONTENDO 1 HBSAG (HUMANO) EM SORO HUMANO TAMPONADO PRECICONTROL HBSAG II QUANT II HBSAG G2 QUANT G2 PC ELECSYS P/N: 07143745190APRESENTACAO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

18258012 - PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: MAX EFF DH5 ALFA CELULAS COMPETENTES - MAX EFF DH5 ALFA CELULAS COMPETENTES (MAX EFF DH5 )
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES CONTROLADORES/CALIBRADORES DO TESTE ELECSYS ANTI-TSHRFAMILIA ELECSYS ANTI-TSHRCAL-SET ANTI-TSHR 2 X 2 ML EACH LEVELP/N: 08496641190APRESENTACAO: CALSET ANTI-TSHR - CAL1 2 X 2.0ML E CAL2 2 X 2.0MLCONDICAO DO PRODUTO: NOVOREGISTRO: 102
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE DE QUALIDADE DO IMUNOENSAIO ELECSYS HBSAG IMUNOENSAIO ELECSYS E COBAS E PC HBSAGQN1: 5 FRASCOS, CADA CONTENDO 1 HBSAG (HUMANO) EM SORO HUMANO TAMPONADO PRECICONTROL HBSAG II QUANT II HBSAG G2 QUANT G2 PC ELECSYS P/N: 07143745190APRESENTACAO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

61029765 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO: NOME COMERCIAL: CHOOZIT MH12 FRO 500 DCU DESCRICAO: Cultura concentrada congelada, na forma de pellets para inoculacao direta no leite. LOTE: 4113841500 - 2,500 kgs (5 EA)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P0710 FAMILIA ALINITY I HIV AG/AB COMBO APRESENTACAO.: ALINITY I HIV AG/AB COMBO CONTROLS - CONTROLE NEGATIVO: 1 X 8,0 ML/CONTROLE POSITIVO 1: 1 X 8,0 ML/CONTROLE POSITIVO 2: 1 X 8,0 ML/CONTROLE POSITIVO 3: 1 X 8,0 ML CONTROLE NEGATIVO: E PREPARADO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN5A2021 - KIT CONTENDO:(8)4.00ML SORO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)LN501, (1)LN502, (1)LN503, (1)LN504, (1)LN505, (1)LN506, (1)LN507, (1)LN508.NÃO INFECCIOSO, NÃO PERIGOSO, N
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN5A2021 - KIT CONTENDO:(8)4.00ML SORO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)LN501, (1)LN502, (1)LN503, (1)LN504, (1)LN505, (1)LN506, (1)LN507, (1)LN508.NÃO INFECCIOSO, NÃO PERIGOSO, N
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC2357-Anticorpos sendo anti rabbit igg fr/200ug Marca: Santa Cruz Utilizado na pesquisa em neurociencias na tecnica de Western blotting, Lot#J2020
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P1010 FAMILIA ALINITY I HBSAG QUALITATIVE II APRESENTACAO.: ALINITY I HBSAG QUALITATIVE II CONTROLS - CONTROLE NEGATIVO: 1 X 8,0 ML/CONTROLE POSITIVO: 1 X 8,0 ML CONTROLE NEGATIVO CONTEM PLASMA HUMANO RECALCIFICADO. CONSERVANTES: PROCLIN 950 E AZID
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR UTILIZADO PARA CALIBRAR O ENSAIO QUANTITATIVO ELECSYS PTH PARA A PTH INTACTA (HORMONA PARATIROIDE) NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E.FAMILIA PTHPTH G2 STAT CS ELECSYSP/N: 08243930190APRESENTACAO: CALSET PTH STAT - CAL1 2X1,
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6401 FAMILIA ALINITY I HBEAG APRESENTACAO.: ALINITY I HBEAG CALIBRATORS - CALIBRADOR 1: 1 X 3,0 ML/CALIBRADOR 2: 1 X 3,0 ML CALIBRADOR 1: CONTEM TAMPAO TRIS COM ESTABILIZANTE DE PROTEINA (BOVINA). CONSERVANTES: AGENTES ANTIMICROBIANOS. CALIBRADOR
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

S9399-.1MG - Codigo do item: S9399-.1MG, Nome Comercial: Enterotoxina estafilococica A deStaphylococcus aureus, Concentracao: <= 100 %, Nr CAS: 642595-84-4, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Com
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

S9399-.1MG - Codigo do item: S9399-.1MG, Nome Comercial: Enterotoxina estafilococica A deStaphylococcus aureus, Concentracao: <= 100 %, Nr CAS: 642595-84-4, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial, Unidade Com
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR UTILIZADO PARA CALIBRAR O ENSAIO QUANTITATIVO ELECSYS PTH PARA A PTH INTACTA (HORMONA PARATIROIDE) NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E. FAMILIA PTH PTH G2 STAT CS ELECSYS P/N: 08243930190 APRESENTACAO: CALSET PTH STAT - CAL1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P8922 FAMILIA ALINITY I ANTI-HBS APRESENTACAO: ALINITY I ANTI-HBS REAGENT KIT - MICROPARTICULAS: 2 X 5,0 ML/CONJUGADO: 2 X 6,1 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO DE SUPERFICIE DA HEPATITE B (SUBTIPOS AD E AY) (E. COLI, DNA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PLASMA HUMANO NORMAL CITRATADO EM POOL, PARA CALIBRACAO DE ENSAIOS DE COAGULACAO SELECCIONADOS NOS EQUIPAMENTOS ANALISADORES COBAS T INDICADOS FAMILIA AT ANTITHROMBIN GLOBAL CALIBRATOR COBAS T411 (5X1ML) P/N: 07149131190 APRESENTACAO: GLOBAL CAL - 5X
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR UTILIZADO PARA DEFINIR PADROES QUANTITATIVOS ELECSYS PROGESTERONE III NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS EPROGESTERONE III CALSETPROGESTERONE G3 CS ELECSYSP/N: 07092547190APRESENTACAO: 4 x 1.0 ML (CAL 1: 2 x 1,0 ML/ Cal 2: 2x1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLES UTILIZADOS PARA FAZER VERIFICACOES DO SISTEMA E TESTES DE CONTROLE DE QUALIDADE DO TEMPO DE PROTROMBINA COM O APARELHO COAGUCHEK PRO II E AS TIRAS-TESTE COAGUCHEK PT TEST STRIPS. FAMILIA COAGUCHEK PT COAGUCHEK PT CONTROLS (LEVEL 1+2) P/N: 0
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR DO ENSAIO QUANTITATIVO ELECSYS FOLATE NO ANALISADOR DE IMUNOENSAIO COBAS E 801FAMILIA ELECSYS FOLATOFOLATE G3 CS ELECSYS E2GP/N: 07396473190APRESENTACAO: CALSET FOLATE - 4 X 1.0 MLCONDICAO DO PRODUTO: NOVOREGISTRO: 10287411231VALIDADE: VIG
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P9201 FAMILIA ALINITY I TOTAL PSA APRESENTACAO: ALINITY I TOTAL PSA CALIBRATOR - CAL 1: 3 ML; CAL 2: 3ML, CAL 1 CONTEM TAMPAO TRIS COM ESTABILIZADOR DE PROTEINA (BOVINA). CAL 2 CONTEM PSA (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZADOR DE PROTE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC3917-0,5ML - ANTICORPO SECUNDARIO,MONOCLONAL,IGG- CONJUGADO TEXAS RED, 200UG/0,5ML-FR/0,5ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR DO ENSAIO QUANTITATIVO ELECSYS FOLATE NO ANALISADOR DE IMUNOENSAIO COBAS E 801FAMILIA ELECSYS FOLATOFOLATE G3 CS ELECSYS E2GP/N: 07396473190APRESENTACAO: CALSET FOLATE - 4 X 1.0 MLCONDICAO DO PRODUTO: NOVOREGISTRO: 10287411231VALIDADE: VIG
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

C8052-.5MG - Codigo do item: C8052-.5MG, Sinonimo: Enterotoxina de colera, Composicao quimica: proteina 5%, Concentracao: 0,95, Densidade: 9.00 - 11.00 mg/ml, Cor: branca, Nr CAS: 9012-63-9,Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

C8052-.5MG - Codigo do item: C8052-.5MG, Sinonimo: Enterotoxina de colera, Composicao quimica: proteina 5%, Concentracao: 0,95, Densidade: 9.00 - 11.00 mg/ml, Cor: branca, Nr CAS: 9012-63-9,Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EXCLUSIVO EM PESQUISA CIENTÍFICA, SENDO: MIL 4-5UG - RECOMBINANTE DE INTERLEUCINA-4 (IL-4), PRODUZIDO EM CAMUNDONGO - 5UG - LOTE: 312PMIL411
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CZQA2021 - KIT CONTENDO: (6)5.00ML SORO,PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (2)CZQ01, (2)CZQ02, (2)CZQ03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CZQA2021 - KIT CONTENDO: (6)5.00ML SORO,PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (2)CZQ01, (2)CZQ02, (2)CZQ03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE UTILIZADO NO CONTROLE DE QUALIDADE DO TESTE ROCHE CARDIAC POC TROPONIN T PARA A MONITORIZACAO DA EXATIDAO E PRECISAOCARDIAC POC TROPONIN T CONTROLROCHE CARDIAC POC TROPONIN T 2-LEVEL CONTROLP/N: 07831005190APRESENTACAO: 2 X 1.0MLCONDICAO DO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR DO ENSAIO QUANTITATIVO ELECSYS FOLATE NO ANALISADOR DE IMUNOENSAIO COBAS E 801 FAMILIA ELECSYS FOLATO FOLATE G3 CS ELECSYS E2G P/N: 07396473190 APRESENTACAO: CALSET FOLATE - 4 X 1.0 ML CONDICAO DO PRODUTO: NOVO REGISTRO: 10287411231 VALIDA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CONTROLE UTILIZADO NO CONTROLE DE QUALIDADE DO TESTE ROCHE CARDIAC POC TROPONIN T PARA A MONITORIZACAO DA EXATIDAO E PRECISAO CARDIAC POC TROPONIN T CONTROL ROCHE CARDIAC POC TROPONIN T 2-LEVEL CONTROL P/N: 07831005190 APRESENTACAO: 2 X 1.0ML CONDICA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

BOST-PB9609-30UG - ANTICORPO LIPOCALIN 2/LCN2 POLICLONAL IGG - 30UG - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : BOSTER BIOLOGICAL TECHNOLOGY
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

S2A2021 - KIT CONTENDO: (2)1.00ML SORO, (8)0.50ML SORO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)HP01, (1)S201, (1)S202, (1)S203, (1)S204, (1)S205, (1)S206, (1)S207, (1)S208, (1)SS01.NÃO I
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

S2A2021 - KIT CONTENDO: (2)1.00ML SORO, (8)0.50ML SORO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)HP01, (1)S201, (1)S202, (1)S203, (1)S204, (1)S205, (1)S206, (1)S207, (1)S208, (1)SS01.NÃO I
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MATERIAL DE USO EM LABORATORIO DE ANALISES E PESQUISAS, NAO TERA USO MEDICO-ODONTO-HOSPITALAR HUMANO OU AGROPECUARIA: 01 X COD.SH30087.03 SORO DE BEZERRO, ORIGEM AMERICANA, 500ML
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CHA-2 - MAS CHEMTRAK-H 2CONTROLE DE QUALIDADE - SENDO: MAS chemTRAK-H 2 - NOME TECNICO:PARAMETROS COMBINADOS NO MESMO PRODUTO - CLASSE III - Apresentacao: 6 x 5 Ml - REGISTRO ANVISA:80254180352 - VALIDADE: 16/03/2030
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CHA-1 - MAS CHEMTRAK-H 1CONTROLE DE QUALIDADE SENDO: MAS chemTRAK-H 1- NOME TECNICO:PARAMETROS COMBINADOS NO MESMO PRODUTO - CLASSE III - Apresentacao: 6 x 5 Ml - REGISTRO ANVISA:80254180352 - VALIDADE: 16/03/2030
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CHA-3 - MAS CHEMTRAK-H 3CONTROLE DE QUALIDADE SENDO: MAS chemTRAK-H 3 - NOME TECNICO:PARAMETROS COMBINADOS NO MESMO PRODUTO - CLASSE III - Apresentacao: 6 x 5 Ml - REGISTRO ANVISA:80254180352 - VALIDADE: 16/03/2030
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN18A2021 - KIT CONTÉM: (5)2.50ML SANGUE TOTAL, PARA FINS DE TESTE DE PROFICIÊNCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETAS: (1)LN1801, (1)LN1802, (1)LN1803, (1)LN1804, (1)LN1805. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO.(USO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN18A2021 - KIT CONTÉM: (5)2.50ML SANGUE TOTAL, PARA FINS DE TESTE DE PROFICIÊNCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETAS: (1)LN1801, (1)LN1802, (1)LN1803, (1)LN1804, (1)LN1805. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO.(USO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN18A2021 - KIT CONTÉM: (5)2.50ML SANGUE TOTAL, PARA FINS DE TESTE DE PROFICIÊNCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETAS: (1)LN1801, (1)LN1802, (1)LN1803, (1)LN1804, (1)LN1805. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO.(USO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN18A2021 - KIT CONTÉM: (5)2.50ML SANGUE TOTAL, PARA FINS DE TESTE DE PROFICIÊNCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETAS: (1)LN1801, (1)LN1802, (1)LN1803, (1)LN1804, (1)LN1805. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO.(USO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MIC007-2EA - Codigo do item: MIC007-2EA, Nome Comercial: E. coli em Agua Potavel e Superficial PT- Quantitativa - WS, Concentracao: <= 100 %, Forma de uso: padrao de referencia para ensaio de proficiencia-STD, Finalidade: comercial/industrial, Unidad
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P3210 FAMILIA ALINITY I CA 19-9XR APRESENTACAO.: ALINITY I CA19-9XR CONTROLS - CONTROL L: 1 X 8,0 ML; CONTROL M: 1 X 8,0 ML; CONTROL H: 1 X 8,0 ML; CONTROL L (BAIXO): CONTEM 40 U/ML DE DETERMINANTES REATIVAS DE 1116-NS-19-9 (HUMANA) PREPARADA EM TA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

KIT DE REAGENTES CONTROLADORES/CALIBRADORES DO TESTE ELECSYS ANTI-TSHR FAMILIA ELECSYS ANTI-TSHR CAL-SET ANTI-TSHR 2 X 2 ML EACH LEVEL P/N: 08496641190 APRESENTACAO: CALSET ANTI-TSHR - CAL1 2 X 2.0ML E CAL2 2 X 2.0ML CONDICAO DO PRODUTO: NOVO REGISTR
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN8A2021 - KIT CONTENDO: (7)4.00ML SORO. PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)LN801, (1)LN802, (1)LN803, (1)LN804, (1)LN805, (1)LN806, (1)LN807.NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRI
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR COMPOSTO POR MATRIZ DE SORO HUMANO LIOFILIZADA, UTILIZADO PARA CALIBRAR O ENSAIO QUANTITATIVO ELECSYS IGF 1 NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E FAMILIA IGF-1 IGF-1 CS ELECSYS P/N: 07475969190 APRESENTACAO: CALSET IGF-1 - 4 X
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

AMOSTRAS DE CULTURA DE BACILLUS FIRMUS (I-1582), PARA SEREM UTILIZADAS EXCLUSIVAMENTE PARA EXPERIMENTACAO NA PHIBRO SAÚDE ANIMAL INTERNACIONAL LTDA (GUARULHOS). POSTERIORMENTE, O MATERIAL EXCEDENTE SERA DESCARTADO, DE ACORDO COM O ESTABELECIDO PELA I
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR COMPOSTO POR MATRIZ DE SORO HUMANO LIOFILIZADA, UTILIZADO PARA CALIBRAR O ENSAIO QUANTITATIVO ELECSYS IGF 1 NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS EFAMILIA IGF-1IGF-1 CS ELECSYSP/N: 07475969190APRESENTACAO: CALSET IGF-1 - 4 X 1.0
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P6410 FAMILIA ALINITY I HBEAG APRESENTACAO.: ALINITY I HBEAG CONTROLS - CONTROLE NEGATIVO: 1 X 8,0 ML/CONTROLE POSITIVO: 1 X 8,0 ML CONTROLE NEGATIVO: CONTEM PLASMA HUMANO RECALCIFICADO. CONSERVANTES: AGENTES ANTIMICROBIANOS. CONTROLE POSITIVO: CON
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SOLUCAO UTILIZADA PARA O CONTROLE DE QUALIDADE DO IMUNOENSAIO ELECSYS EVEROLIMUS NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E FAMILIA EVEROLIMUS ISD-EVEROLIMUS PC ELECSYS P/N: 07294131190 APRESENTACAO PRECICONTROL EVEROLIMUS - PC EVL1 1 X 3.0ML,
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SOLUCAO UTILIZADA PARA O CONTROLE DE QUALIDADE DO IMUNOENSAIO ELECSYS EVEROLIMUS NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E FAMILIA EVEROLIMUS ISD-EVEROLIMUS PC ELECSYS P/N: 07294131190 APRESENTACAO PRECICONTROL EVEROLIMUS - PC EVL1 1 X 3.0ML,
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SOLUCAO UTILIZADA PARA O CONTROLE DE QUALIDADE DO IMUNOENSAIO ELECSYS EVEROLIMUS NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E FAMILIA EVEROLIMUS ISD-EVEROLIMUS PC ELECSYS P/N: 07294131190 APRESENTACAO PRECICONTROL EVEROLIMUS - PC EVL1 1 X 3.0ML,
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P1001 FAMILIA ALINITY I HBSAG QUALITATIVE II APRESENTACAO.: ALINITY I HBSAG QUALITATIVE II CALIBRATORS - CAL 1: 1 X 3,0 ML/CAL 2: 1 X 3,0 ML CAL 1 CONTEM HBSAG HUMANO PURIFICADO INATIVADO (SUBTIPO AD) EM TAMPAO FOSFATO COM OS ESTABILIZANTES PLASMA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P4301 FAMILIA ALINITY C HEMOGLOBIN A1C APRESENTACAO: ALINITY C HEMOGLOBIN A1C CALIBRATORS - CAL 1: 1 X 1,6 ML / CAL 2: 1 X 1,6 ML CAL 1 E 2: (LIOFILIZADO) CONTEM HEMOGLOBINA E HEMOGLOBINA GLICADA PROVENIENTES DE SANGUE TOTAL HUMANO. ANTES DA LIOFIL
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P8952 FAMILIA ALINITY I ANTI-HBS APRESENTACAO: ALINITY I ANTI-HBS REAGENT KIT - MICROPARTICULAS: 2 X 5,0 ML/CONJUGADO: 2 X 6,1 ML/DILUENTE DE AMOSTRA: 2 X 5,9 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO DE SUPERFICIE DA HEPATITE B (S
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

1102740002 COD. DO ITEM: 1102740002, NOME COMERCIAL: STERIKON BIOINDICADOR, NOME CIENTIFICO: SUSPENSAO DE ESPOROS GEOBACILLUS STEAROTHERMOPHILUS, CONCENTRACAO: 5.0E+05 - 1.0E+07 SPOROS POR UNIDADE, DENSIDADE: 1 G/CM3, COR: VIOLETA AVERMELHADA, ODOR:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR DO ENSAIO QUANTITATIVO ELECSYS TROPONIN I NO ANALISADOR DE IMUNOENSAIO COBAS E 801 FAMILIA ELECSYS TROPONIN I TROPONIN I CS ELECSYS E2G P/N: 07439547190 APRESENTACAO: CALSET TROPONIN I - 4 X 1.0 ML CONDICAO DO PRODUTO: NOVO REGISTRO: 10287
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN6A2021 - KIT CONTÉM: (18)4.00ML URINA SIMULADA. PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO.ETIQUETA: (1)LN601, (1)LN602, (1)LN603, (1)LN604, (1)LN605, (1)LN606, (1)LN607, (1)LN608, (1)LN609, (1)LN610, (1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN6A2021 - KIT CONTÉM: (18)4.00ML URINA SIMULADA. PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO.ETIQUETA:(1)LN601,(1)LN602,(1)LN603,(1)LN604,(1)LN605,(1)LN606,(1)LN607,(1)LN608,(1)LN609,(1)LN6010,(1)LN6011,(1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR DO ENSAIO QUANTITATIVO ELECSYS TROPONIN I NO ANALISADOR DE IMUNOENSAIO COBAS E 801FAMILIA ELECSYS TROPONIN ITROPONIN I CS ELECSYS E2GP/N: 07439547190APRESENTACAO: CALSET TROPONIN I - 4 X 1.0 MLCONDICAO DO PRODUTO: NOVOREGISTRO: 10287411280
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SEMA2021 - KIT CONTENDO: (2)LÂMINA COM ESPERMA, (2)0.30ML ESPERMA. PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)PV01, (1)PV02, (1)SEM03, (1)SEM04. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO.(U
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MIC002-2EA - Codigo do item: MIC002-2EA, Nome Comercial: Contagem de placa padrao PT - WS, Forma de uso: controle de qualidade, Finalidade: comercial/industrial, Unidade Comercializada: embalagem com 2 unidades, Forma de apresentacao: solido Pedido:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FRASCOS LIVRES DE METAIS PESADOS, DE USO DO LABORATÓRIO (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

EC0112 - PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: REAGENTE CELULAS DH5ALFA COMPETENTES 20 REACOES
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P3201 FAMILIA ALINITY I CA 19-9XR APRESENTACAO: ALINITY I CA19-9XR CALIBRATORS - CAL A: 1 X 3,0 ML; CAL B: 1 X 3,0 ML; CAL C: 1 X 3,0 ML; CAL D: 1 X 3,0 ML; CAL E: 1 X 3,0 ML; CAL F: 1 X 3,0 ML. CALIBRADOR A: CONTEM TAMPAO TRIS EM ESTABILIZANTE DE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN3A2021 - KIT CONTÉM: (7)4.00ML DE SORO, PARA FINS DE TESTE DE PROFICIÊNCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETAS: (1)LN301, (1)LN302, (1)LN303, (1)LN304, (1)LN305, (1)LN306, (1)LN307.NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTR
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P5010 FAMILIA ALINITY I HE4 APRESENTACAO: ALINITY I HE4 CONTROLS - 3 X 8.0 ML OS CONTROLES SAO PREPARADOS EM TAMPAO PBS COM UM ESTABILIZADOR DE PROTEINA (BOVINA). CONSERVADOR: PROCLIN 300. ALINITY I HE4 CONTROLS SAO UTILIZADOS PARA A VERIFICACAO D
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

PM3A2021 - (1)LÂMINA COM TECIDO HUMANO PARA ANALISE TIPO MICROARRAY, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETA: (1)PM301. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P9201 FAMILIA ALINITY I TOTAL PSA APRESENTACAO: ALINITY I TOTAL PSA CALIBRATOR - CAL 1: 3 ML; CAL 2: 3ML, CAL 1 CONTEM TAMPAO TRIS COM ESTABILIZADOR DE PROTEINA (BOVINA). CAL 2 CONTEM PSA (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZADOR DE PROTE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LN20A2021 - KIT CONTENDO: (6)5.00mL DE URINA, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO ETIQUETAS: (1)LN2001, (1)LN2002, (1)LN2003, (1)LN2004, (1)LN2005, (1)LN2006NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRIT
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

NNOME E/OU CODIGO: RTI301REGISTRO MAPA: 146/2021TIPO DE FORMULACAO: SolidoESTADO FISICO: SolidoFASE DO EXPERIMENTO: Fase ICLASSIFICACAO AMBIENTAL PRELIMINAR: Classe I - Altamente perigoso ao meio ambienteCLASSIFICACAO TOXICOLOGICA PRELIMINAR: Classe
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR DO ENSAIO QUANTITATIVO ELECSYS MYOGLOBIN NO ANALISADOR DE IMUNOENSAIO COBAS E 801 FAMILIA ELECSYS MYOGLOBIN MYOGLOBIN CS ELECSYS E2G P/N: 07394675190 APRESENTACAO: CALSET MYOGLOBIN - CAL1 2 X 1.0ML CAL2 2 X 1.0ML CONDICAO DO PRODUTO: NOVO
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR DO ENSAIO QUANTITATIVO ELECSYS FOLATE NO ANALISADOR DE IMUNOENSAIO COBAS E 801 FAMILIA ELECSYS FOLATO FOLATE G3 CS ELECSYS E2G P/N: 07396473190 APRESENTACAO: CALSET FOLATE - 4 X 1.0 ML CONDICAO DO PRODUTO: NOVO REGISTRO: 10287411231 VALIDA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CRA2021 - KIT CONTÉM: (3)1.00ML SORO. PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)HMS01, (1)HMS02, (1)HMS03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO).
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MA2021 - KIT CONTENDO: (3)5.00ML LÍQUIDO SIMULANDO LCR - LÍQUIDO CEFALO RAQUIDIANO. PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)M01, (1)M02, (1)M03.NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

MA2021 - KIT CONTENDO: (3)5.00ML LÍQUIDO SIMULANDO LCR - LÍQUIDO CEFALO RAQUIDIANO, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLÍNICO. ETIQUETAS: (1)M01, (1)M02, (1)M03.NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNG - Codigo do item: SHCLNG, Nome comercial: MISSIO shRNA,Concentracao:>= 10 - < 20 %, Nr CAS: 56-81-5, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial , Forma de apresentacao: solido, Temperatura de armazenagem:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNG - Codigo do item: SHCLNG, Nome comercial: MISSIO shRNA,Concentracao:>= 10 - < 20 %, Nr CAS: 56-81-5, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial , Forma de apresentacao: solido, Temperatura de armazenagem:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNG - Codigo do item: SHCLNG, Nome comercial: MISSIO shRNA,Concentracao:>= 10 - < 20 %, Nr CAS: 56-81-5, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial , Forma de apresentacao: solido, Temperatura de armazenagem:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNG - Codigo do item: SHCLNG, Nome comercial: MISSIO shRNA,Concentracao:>= 10 - < 20 %, Nr CAS: 56-81-5, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial , Forma de apresentacao: solido, Temperatura de armazenagem:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SHCLNG - Codigo do item: SHCLNG, Nome comercial: MISSIO shRNA,Concentracao:>= 10 - < 20 %, Nr CAS: 56-81-5, Forma de uso: pesquisa e desenvolvimento (R&D), Finalidade: comercial/industrial , Forma de apresentacao: solido, Temperatura de armazenagem:
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

FSMA2021 - KIT CONTÉM: (3)LÂMINAS FIXADAS, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)FSM01, (1)FSM02, (1)FSM03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

07P9301 FAMILIA ALINITY I FREE PSA APRESENTACAO: ALINITY I FREE PSA CALIBRATORS - CAL 1: 3ML; CAL 2: 3ML CAL 1 CONTEM TAMPAO TRIS COM ESTABILIZANTE DE PROTEINA (BOVINA). CAL 2 CONTEM PSA (HUMANO) PREPARADO EM TAMPAO TRIS COM ESTABILIZANTE DE PROTEINA
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

WBGQA2021 - (3)2.00ML GLÓBULOS VERMELHOS DO SANGUE, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)WBGQ01, (1)WBGQ02, (1)WBGQ03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

WBGQA2021 - (3)2.00ML GLÓBULOS VERMELHOS DO SANGUE, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)WBGQ01, (1)WBGQ02, (1)WBGQ03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CRA2021 - KIT CONTÉM: (3)0.50ML SORO. PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. ETIQUETAS: (1)HSCRP01,(1)HSCRP02, (1)HSCRP03. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO).
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

NGCB2021 - KIT CONTENDO: (5)LÂMINAS DE ESFREGAÇO DE SECREÇÃO NÃO GINECOLÓGICA, PARA FINS DE TESTE DE PROFICIENCIA PARA AVALIACAO DA PERFORMANCE DO LABORATORIO CLINICO. EITQUETAS: (1)NGC01, (1)NGC02, (1)NGC03, (1)NGC04, (1)NGC05.NÃO INFECCIOSO, NÃO PE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC365436-10UG - ANTICORPO MPO LIGHT CHAIN A-5, MONOCLONAL, IGG1 - FR/10UG/ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC393894-10UG - ANTICORPO CD20 D-10, MONOCLONAL, IGM - FR/10UG/ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC515946-10UG - ANTICORPO D-1, IGG, MONOCLONAL -10UG/ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC5310-10UG - ANTICORPO CAVEOLIN-3 (A-3), IGG1 - 10UG - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC365712-10UG - ANTICORPO VWF C-12, IGG1, MONOCLONAL -10UG/ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC53295-10UG - ANTICORPO JC159, GLICOFORINA A, IGG1, MONOCLONAL -10UG/ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC7314-10UG - AMOSTRA DE ANTICORPO MUCIN 2 (CCP58) MONOCLONAL, IGG1K - FR/10UG - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

08P0701 FAMILIA ALINITY I HIV AG/AB COMBO APRESENTACAO.: ALINITY I HIV AG/AB COMBO CALIBRATOR - 1 X 3,0 ML CONTEM LISADO VIRAL DE HIV PURIFICADO PREPARADO EM SOLUCAO SALINA TAMPONADA TRIS COM ESTABILIZANTE DE PROTEINA (BOVINA). CONSERVANTE: AZIDA SOD
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC101315-10UG - ANTICORPO ANTI-EBV LMP-2A 15F9, MONOCLONAL, IGG1 - FR/10UG/ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC20047-10UG - ANTICORPO CD3 PC3/188A, MONOCLONAL, IGG1 - FR/10UG/ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC373823-10UG - ANTICORPO A-9, IGA, MONOCLONAL -10UG/ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

SANT-SC53347-10UG - ANTICORPO R1/69, IGM, MONOCLONAL -10UG/ML - APLICACAO : UTILIZADO EM LABORATORIOS DE PESQUISA DE CONTROLE DE INDUSTRIAS OU PESQUISA CIENTIFICA EM ORGAO GOVERNAMENTAL - MARCA : SANTA CRUZ
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CALIBRADOR UTILIZADO PARA CALIBRAR O ENSAIO QUANTITATIVO ELECSYS PTH PARA A PTH INTACTA (HORMONA PARATIROIDE) NOS ANALISADORES DE IMUNOENSAIO ELECSYS E COBAS E. FAMILIA PTH PTH G2 STAT CS ELECSYS P/N: 08243930190 APRESENTACAO: CALSET PTH STAT - CAL1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR D049.7 GABLETOP, 200U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. 0000080683 - prod. 16/04/19 - venc. 16
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR D029.7 GABLETOP, 200U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. LW00002587 - prod. 27/01/21 - venc. 27
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR D227.7 GABLETOP, 150U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. LW00002348 - prod. 18/01/21 - venc. 18
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR S310.7 GABLETOP, 1000U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. LW00000970 - pro. 11/11/20 - venc. 11
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR S811.7 GABLETOP, 1500U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. LW00003793 - prod. 22/03/21 - venc. 2
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR Y508.7 GABLETOP, 250U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. 0000081379 - prod. 23/12/19 - 23/06/22
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR D229.7 GABLETOP, 200U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. LW00001215 - prod. 23/11/20 - venc. 23
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR K308.7 GABLETOP, 500U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. LW00001749 - prod. 16/12/20 - venc. 16
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR Z410.7 GABLETOP, 500U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. LW00001838 - prod. 21/12/20 - venc. 21
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR O400.7 GABLETOP, 500U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr.LW00001621 - prod. 13/12/20 - venc. 13/
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR F400.7 GABLETOP, 500U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. 0000080624 - prod. 25/03/19 - venc. 25
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR F800.7 GABLETOP, 500U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. 0000080613 - prod. 22/03/19 - venc. 22
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR L200.7 GABLETOP, 500U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. LW00003119 - prod. 18/02/21 - venc. 18
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR G100.7 GABLETOP, 500U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. LW00000873 - prod. 06/11/20 - venc. 06
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR Y529.7 GABLETOP, 250U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. 0000081493 - prod. 12/02/20 - venc. 12
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR PF300.7 GABLETOP, 500U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lotes nrs. 0000081466, LW00002723 - prod.03/02
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR W148.7 GABLETOP, 400U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. LW00000140 - prod. 08/10/20 - venc. 08
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR Z510.7 GABLETOP, 500U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. LW00002724 - prod. 02/02/21 - venc. 02
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

440300 PRODUTO PARA USO EXCLUSIVO EM PESQUISA CIENTIFICA, SENDO: KIT TOP10F ONESHOT ( TOP10F ONE SHOT KIT )
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR U102.7 GABLETOP, 500U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. 0000081259 - prod. 05/11/19 - venc. 05
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

BUF - Nome: Tampao Diluente para PSA (Individual). 01 FRASCO COM 50 ML DE TAMPAO DE EXTRACAO PRODUTO AUXILIAR PARA DILUICOES NO TESTE DE PSA SERATEC. FRASCO PLASTICO DESCARTAVEL COM VOLUME DE 50 ML. DE SOLUCAO-TAMPAO. UNICAMENTE PARA USO FORENSE
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR Y501.6 GABLETOP, 125U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. 0000081563 - prod. 10/03/20 - venc. 10
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR P115.6 GABLETOP, 750U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. LW00001396 - prod. 30/11/20 - venc. 30
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

ANTIGENO NO GRAU DE PESQUISA LEP-F1
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

000100 - SOY PEPTONE SUBSTRACT - Regente de Peptona a base de soja usada exclusivamente para analise de microbiologia em laboratorio interno.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CESKA-STAR P114.6 GABLETOP, 500U Culturas congeladas altamente concentradas de bacterias produtoras de acido latico; Finalidade: Utilizacao na fabricacao de queijos e iogurtes na industria de laticinios;lote nr. 0000081753 - prod. 07/05/20 - venc. 07
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

AMOSTRA - LEUCÓCITOS DE ORIGEM HUMANA, DE USO DO LABORATÓRIO (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

LEUCÓCITOS E ERITRÓCITOS, DE USO DO LABORATÓRIO (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

000060 - CONTAINER PLASTIC OF CARRAGEENAN - Frasco de plastico Carragena Kappa - Material exclusivo para estudos em laboratorio interno.
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

CELULAS - GLÓBULOS VERMELHOS DO SANGUE, PARA USO NO LABORATORIO. NÃO INFECCIOSO, NÃO PERIGOSO, NÃO RESTRITO. (USO NÃO HUMANO)
2021-04  -  qtd: (login necessário)  -  valor: (login necessário)

720787 - Cultura de microrganismo liofilizado (Bacillus licheniformis FMCH001) marca CH-200, utilizada exclusivamente como matéria-prima para produção de nematicida microbiológico marca Quartzo - registro no MAPA sob no. 0317 - processo no. 21000.013
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

503925 - Cultura de microrganismo liofilizado (Bacillus subtilis FMCH002) marca CH-201, utilizada exclusivamente como matéria-prima para produção de nematicida microbiológico marca Quartzo e Presence - registro MAPA sob no. 1817 Processo nº: 21000.04
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

PAN00446018 ENTEROGERMINA 2BCFU/5ML SUSP BTX10 BR - NOME COMERCIAL: ESPOROS DE BACILLUS CLAUSII EM SUSPENSAO - CATEGORIA: SUBSTANCIAS BIOATIVAS E PROBIOTICOS ISOLADOS COM ALEGACAO DE PROPRIEDADES FUNCIONAIS E/OU DE SAUDE. - DESCRICAO: ALIMENTO FUNCIO
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

43175976 - PROBIOTICO PREBLEND PP017 MICROORGANISMOS VIVOS QUE SERAO UTILIZADOS NA FABRICACAO DE FORMULA INFANTIL PARA BENEFICIAR A FLORA INTESTINAL (MATERIA PRIMA PARA FABRICACAO DO MUCILON). LOTE: 10290017P1 FAB: 29/01/2021 VAL: 26/09/2021LOTE: 103
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

100227 - Cultura de microrganismos liofilizados (Streptococcus thermophilus e lactobacillus helveticus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS TCC-20 - cada caixa contem 20 envelopes.
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

717225 - Cultura de microrganismos congelados (Lactobacillus rhamnosus) empregados como fermentos lácteos na preparação de derivados de leite iogurte, quefir, ácido lático)F-DVS FreshQ® 10 - cada caixa contem 10 pacotes
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

23200-030-LF-SB - BACILLUS LIQUENIFORMIS - MICRORGANISMO NA CONCENTRACAO DE 1x10¬11 UFC/G, EM PO, UTILIZADO COMO INSUMO PARA A FORMULACAO DO PRODUTO BIO GRAN WT. MICRORGANISMO NAO PATOGENICO, NAO OGM, CLASSIFICADO COMO NIVEL 1 DE BIOSSEGURANCA. DA MA
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

23200-030-ST-SB - BACILLUS SUBTILIS - MICRORGANISMO NA CONCENTRACAO DE 1X10¬8 UFC/G, EM PO, UTILIZADO COMO INSUMO PARA A FORMULACAO DO PRODUTO BIO GRAN WT. MICRORGANISMO NAO PATOGENICO, NAO OGM, CLASSIFICADO COMO NIVEL 1 DE BIOSSEGURANCA. DA MANEIRA
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

23200-030-TG-SB - BACILLUS SUBTILIS - MICRORGANISMO NA CONCENTRACAO DE 1x10¬11 UFC/G, EM PO, UTILIZADO COMO INSUMO PARA A FORMULACAO DO PRODUTO BIO GRAN WT. MICRORGANISMO NAO PATOGENICO, NAO OGM, CLASSIFICADO COMO NIVEL 1 DE BIOSSEGURANCA. DA MANEIRA
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

87026264 - PONDDTOX-BAYER BR-PL10 KG US - NOME COMERCIAL: PROQUATIC POND DTOX - PREPARACAO A BASE DE CULTURA DE MICRORGANISMOS ESTADO FISICO: SOLIDO (PO). - APRESENTACAO: BALDE CONTENDO 10 KG. - INDICACAO: ELIMINACAO DO GAS SULFIDRICO (H2S)- TOXICO D
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

61015954 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO. SENDO: NOME COMERCIAL: KP - HOWARU Dophilus 200B - 1 KG (PAREVE) Descricao: Cultura probiotica liofilizada. Cor branca a creme.Composicao: Lactobacillus acidophilus (NCFM)
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

707753 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-9 - Cada caixa contém 10ev
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

23200-030-PL-SB - BACILLUS PASTEURI - MICRORGANISMO NA CONCENTRACAO DE 1x10¬11 UFC/G, EM PO, UTILIZADO COMO INSUMO PARA A FORMULACAO DO PRODUTO BIO GRAN WT. MICRORGANISMO NAO PATOGENICO, NAO OGM, CLASSIFICADO COMO NIVEL 1 DE BIOSSEGURANCA. DA MANEIRA
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

703028 - Cultura de microrganismos liofilizados (Lactobacillus delbrueckii subsp. bulgaricus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS YoFlex Mild 1.0 - cad
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

709107 - Cultura de microrganismos congelados (Lactobacillus delbrueckii subsp. bulgaricus Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS DN WHITE-2- cada cx cont
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

704889 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-6 - Cada caixa contém 10ev
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

707752 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-08 10X500U - cada caixa contem 10 Ev
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

715426 - Cultura de microrganismos liofilizados (Lactobacillus helveticus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS TCC-51- Cada caixa contém 25 envelopes.
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

715461 - Cultura de microrganismos liofilizados (Lactobacillus helveticus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS TCC-52 de 200U - cada caixa contem 25ev
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

61015875 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO. SENDO: NOME COMERCIAL: KP - Lc-11 300B - 1 KG (PAREVE) Descricao: Cultura probiotica liofilizada. Cor branca a creme. Composicao: Lactobacillus casei (Lc-11)Embalagem: Sac
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

715461 - Cultura de microrganismos liofilizados (Lactobacillus helveticus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS TCC-52 de 200U - cada caixa contem 25ev
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

704747 - Cultura de microrganismo congelado (Streptococcus thermophilu, Lactobacillus delbrueckii subsp. bulgaricus, Lactococcus and bifidobacterium) empregada como fermento lácteo na preparação de iogurte- F-DVS - DN 560003 - caixas contendo 10 enve
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

100157 - Cultura de microrganismos liofilizados (Lactococcus Latis Cremoris, lactococcus lactis subsp. Lactis) empregados como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - FD-DVS R-704 - cada caixa contem 20 e
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

715693 - Culturas de microrganismos congeladas (Streptococcus thermophilus), empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS® STI-10?X500U (antigo SoMozz Daily 1.1) - Cada caixa contém 10 env
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

703082 - Cultura de microrganismos liofilizados (Lactococcus lactis subsp. cremoris, Lactococcus lactis subsp. lactis, Lactobacillus helveticus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte,
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

23200-030-AF-SB - BACILLUS AMYLOLIQUEFACIENS - MICRORGANISMO NA CONCENTRACAO DE 1x10¬11 UFC/G, EM PO, UTILIZADO COMO INSUMO PARA A FORMULACAO DO PRODUTO BIO GRAN WT. MICRORGANISMO NAO PATOGENICO, NAO OGM, CLASSIFICADO COMO NIVEL 1 DE BIOSSEGURANCA. D
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

703082 - Cultura de microrganismos liofilizados (Lactococcus lactis subsp. cremoris, Lactococcus lactis subsp. lactis, Lactobacillus helveticus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte,
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

7100208296 / 70201177840 / 92486 / 001 - PACOTE TESTE DESAFIO MODELO 41482V. UTILIZADO NO PROCESSO DE ESTERILIZACAO POR VAPOR NA AREA DA SAUDE. COMPOSTO COM UM INTEGRADOR QUIMICO STERIGAGE E UM INDICADOR BIOLOGICO (GEOBACILLUS STEAROTHERMOPHILUS) DE
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO TEC HT-10A DSL, 100 unit Descri Æo do produto: Culturas liofilizadas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nioslotes nrs. 598859/30, 5988
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

DELVO TEC HT-10C DSL, 100 unit Descri Æo do produto: Culturas liofilizadas altamente concentradas de bact rias produtoras de acido latico; Finalidade: Utiliza Æo na fabrica Æo de queijos e iogurtes na ind£stria de latic¡nios;lote nr. 598859/40 - prod
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

7000002632 / 70200620527 / 89621 / 001 - CULTURA DE MICROORGANISMOS. INDICADOR BIOLOGICO, CONTENDO CULTURA DE MICROOORGANISMOS (B.STEAROTHERMOPHILUS) EM TIRAS DE PAPEL DE FILTRO, ARMAZENADAS EM FRASCOS PLASTICOS, UTILIZADO PARA MONITORAR ESTERILIZACA
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

07P6032FAMILIA ALINITY I SYPHILIS TPAPRESENTACAO.: ALINITY I SYPHILIS TP REAGENT KIT - MICROPARTICULAS: 2 X 16,8 ML/CONJUGADO: 2 X 16,3 ML/DILUENTE DE ENSAIO: 2 X 28,7 MLMICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO TP (E.COLI, RECOMBINANTE
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

711469 - Cultura de microrganismos liofilizados (Lactobacillus helveticus Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte,quefir,ácido lático) FD-DVS TCC-50 cada cx contem 25 ev
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

711469 - Cultura de microrganismos liofilizados (Lactobacillus helveticus Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte,quefir,ácido lático) FD-DVS TCC-50 cada cx contem 25 ev
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

715426 - Cultura de microrganismos liofilizados (Lactobacillus helveticus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS TCC-51- Cada caixa contém 25 envelopes.
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

07P8932 FAMILIA ALINITY I ANTI-HBS APRESENTACAO: ALINITY I ANTI-HBS REAGENT KIT - MICROPARTICULAS: 2 X 19,9 ML/CONJUGADO: 2 X 31,6 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO DE SUPERFICIE DA HEPATITE B (SUBTIPOS AD E AY) (E. COLI,DNA
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

717225 - Cultura de microrganismos congelados (Lactobacillus rhamnosus) empregados como fermentos lácteos na preparação de derivados de leite iogurte, quefir, ácido lático)F-DVS FreshQ® 10 - cada caixa contem 10 pacotes
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

705901 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-07 10X500U - cada caixa contem 10 Ev
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

717225 - Cultura de microrganismos congelados (Lactobacillus rhamnosus) empregados como fermentos lácteos na preparação de derivados de leite iogurte, quefir, ácido lático)F-DVS FreshQ® 10 - cada caixa contem 10 pacotes
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

08H5902 CELL-DYN 26 PLUS CONTROL (LOW, NORMAL AND HIGH) APRESENTACAO: MEIA EMBALAGEM: 6 TUBOS DE 2,5 ML CADA, SENDO CONTROLE BAIXO, CONTROLE NORMAL E CONTROLE ALTO. CELL-DYN 26 PLUS CONTROL E UM REAGENTE PARA USO DIAGNOSTICO IN VITRO, CONTENDO COMPON
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

703028 - Cultura de microrganismos liofilizados (Lactobacillus delbrueckii subsp. bulgaricus e Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS YoFlex Mild 1.0 - cad
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

643491-A35 FERMENTO PARA FABRICACAO DE QUEIJO, SAO CULTURAS LACTEAS LIOFILIZADAS COMPOSTA POR LINHAGENS SELECIONADAS DE STREPTOCOCCUS SALIVARIUS SUBSP THEMOPHILUS, UTILIZADO NA INDUSTRIA DE LATICINIO, ACONDICIONADO EM SACHETS (SACOLASHERMETICAMENTE F
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

697994 - Cultura de microrganismos liofilizados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) FD-DVS STI-13 - cada caixa contem 25 envelopes.
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

697993 - Cultura de microrganismos liofilizados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - FD-DVS STI-12-cada caixa contem 25 envelopes.
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

77170-52-00 - MEAT RIPENING GY2, 200 Kg Descri Æo do produto: Cultura liofilizada utilizada em produtos carnicos curados. lotes nrs. 9676020622, 9748010722, 9748020722, 9748030722, prod. 23/12/20,20/01/21. venc. 06/22, 07/22
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

1277838 - CULTIVOS PARA FABRICACAO DE PRODUTOS LACTEOS, SENDO : NOME COMERCIAL: CHOOZIT SWIFT 516 FRO 750 DCUDESCRICAO: Caracteriza-se como cultura congelada de microrganismos, mais particularmente como culturas de Streptococcus thermophilus altament
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

709107 - Cultura de microrganismos congelados (Lactobacillus delbrueckii subsp. bulgaricus Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS DN WHITE-2- cada cx cont
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

IMUNOENSAIO PARA DETERMINACAO QUANTITATIVA IN VITRO DA TROPONINA T CARDIACA EM SORO E PLASMA HUMANOS. FAMILIA ELECSYS TROPONIN T HS TROPONIN T HS STAT ELECSYS COBAS E100 V2 P/N: 08469814190 APRESENTACAO: ELECSYS TROPONIN T HS STAT - 100 TESTES - M 6,
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

IMUNOENSAIO PARA DETERMINACAO QUANTITATIVA IN VITRO DA TROPONINA T CARDIACA EM SORO E PLASMA HUMANOS. FAMILIA ELECSYS TROPONIN T HS TROPONIN T HS STAT ELECSYS COBAS E100 V2 P/N: 08469814190 APRESENTACAO: ELECSYS TROPONIN T HS STAT - 100 TESTES - M 6,
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

F002867 CULTURA LÁTICA TERMOFÍLICA LIOFILIZADA, SH 092 F-050= (LYOFAST UC 50), PARA APLICAÇÃO EM QUEIJOS - LOTE: C285388A
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

704889 - Cultura de microrganismos congelados (Streptococcus thermophilus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-DVS STI-6 - Cada caixa contém 10ev
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

F008920 CULTURA LÁTICA TERMOFÍLICA LIOFILZADA, LYOFAST LB. CASEI LC4 P1 D0050 , PARA APLICAÇÃO EM QUEIJOS - LOTE: C282837A
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

715383 - Cultura de microrganismo liofilizado (Lactobacillus sakei, Pediococcus acidilactici e Staphylococcus carnosus), para uso exlusivo em indústrias cárnicas para fermantação em embutidos, marca: SafePro® FLORA ITALIA LC US. Cada caixa contém 25
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

61015076 - CULTURA DE MICROORGANISMOS, FERMENTO LACTEO E CARNICOS LIOFILIZADO. SENDO: NOME COMERCIAL: KP - Lpc-37 400B - 1 KG (PAREVE) Descricao: Cultura probiotica liofilizada. Cor branca a creme. Composicao: Lactobacillus paracasei (Lpc-37)Embalage
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

704952 - Cultura de microrganismos congelados (Streptococcus thermophilus, Lactobacillus fermentum e Lactobacillus delbrueckii subsp. bulgaricus) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-D
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

715383 - Cultura de microrganismo liofilizado (Lactobacillus sakei, Pediococcus acidilactici e Staphylococcus carnosus), para uso exlusivo em indústrias cárnicas para fermantação em embutidos, marca: SafePro® FLORA ITALIA LC US. Cada caixa contém 25
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

704996 - Cultura de microrganismo congelado ( Lactobacillus delbrueckii subsp. bulgaricus, Lactobacillus fermentum e Streptococcus thermophilus ) empregada como fermento lácteo na preparação de derivados de leite (iogurte, quefir, ácido lático) - F-D
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

7000002632 / 70200620527 / 92454 / 001 - CULTURA DE MICROORGANISMOS. INDICADOR BIOLOGICO, CONTENDO CULTURA DE MICROOORGANISMOS (B.STEAROTHERMOPHILUS) EM TIRAS DE PAPEL DE FILTRO, ARMAZENADAS EM FRASCOS PLASTICOS, UTILIZADO PARA MONITORAR ESTERILIZACA
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

F002785 CULTURA LÁTICA MESOFÍLICA LIOFILIZADA, PB 1-D0050=(LYOFAST UC 50), PARA APLICAÇÃO EM LEITES FERMENTADOS E QUEIJOS - LOTE: C284270A
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

08P0732FAMILIA ALINITY I HIV AG/AB COMBO APRESENTACAO: ALINITY I HIV AG/AB COMBO REAGENT KIT - MICROPARTICULAS: 2 X 32,1 ML/CONJUGADO: 2 X 31,6 ML/DILUENTE DE ENSAIO: 2 X 31,8 ML MICROPARTICULAS: MICROPARTICULAS REVESTIDAS DE ANTIGENO HIV-1/HIV-2 (RE
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

704747 - Cultura de microrganismo congelado (Streptococcus thermophilu, Lactobacillus delbrueckii subsp. bulgaricus, Lactococcus and bifidobacterium) empregada como fermento lácteo na preparação de iogurte- F-DVS - DN 560003 - caixas contendo 10 enve
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

704747 - Cultura de microrganismo congelado (Streptococcus thermophilu, Lactobacillus delbrueckii subsp. bulgaricus, Lactococcus and bifidobacterium) empregada como fermento lácteo na preparação de iogurte- F-DVS - DN 560003 - caixas contendo 10 enve
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

501095 - Cultura de microrganismos liofilizados (Pediococcus pentosaceus e Staphylococcus xylosus) empregada como fermento em produtos embutidos nas indústrias frigorificas - Bactoferm T-SPX 100 - Cada caixa contém 50 ev. de 25g cada.
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)

3766R - PFD-PROQ 11 PLUS 40 UC - PFD 40 U IDC - PFD 40 U IDC - QGE 50 U IDC - FERMENTO - Fermento lacteo liofilizado QGE - 50 UC (unidade de concentracao), da especie Streptococcus salivarius subespecie thermophilus; em po, embalado em envelopes de 9
2021-03  -  qtd: (login necessário)  -  valor: (login necessário)